KEGG   Caldisericum exile: CSE_09320Help
Entry
CSE_09320         CDS       T01804                                 

Definition
(GenBank) N-terminal deblocking aminopeptidase
Organism
cex  Caldisericum exile
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(915801..916793)
Genome map
AA seq 330 aa AA seqDB search
MEELIEKLVKVFGPSSREDKVKNLIKEELKKCECEISIDKFGNLIAHIPQNGPKLMLASH
LDTIGFIITDVDKNGLIRFTSIGGLRTSFLLGSRVLFENGILGTIYYDDRENLWEPKEFK
IEKYFIDIGAKSKKDALNLVSIGMEGIFYPQFFLNGDRIISPSLDDRSGCAVLVELLKNV
KKKSLKYDLYAVFTVQEEVGVKGARTSTYEITPDFGIAVDVTTAGDFLDPHINALELGKG
PAIKVMDGGMITNTDLRNELVNIARKNNIPYQLEVITGGTTDAFAMQITKEGVKTAAISI
PTRYVHTQGELADINDIKNTVALLKNFIEK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggaagagttaatagaaaaattggttaaggtttttgggccttcgtcaagagaagataaa
gttaaaaacctaataaaggaagaacttaaaaagtgtgagtgcgaaatttcgattgataag
tttggaaatcttattgcgcatattcctcaaaatgggccgaaactaatgcttgcttctcat
cttgacacgattggcttcataataactgatgttgataaaaacggtttaataaggtttact
tcgattggtggattgaggacttcttttttattgggtagtcgtgtactttttgagaatggc
attttgggtacaatttattacgatgatagagaaaatctttgggagcccaaagagtttaaa
attgagaaatattttatagacataggtgcaaaaagcaagaaggatgccttaaatcttgta
agtattggaatggaaggtattttttatccgcaattttttttaaacggtgataggataatt
tcaccttcacttgacgacaggtctggctgtgctgttcttgttgaacttctgaagaacgta
aagaaaaaaagtctaaaatatgacttgtacgcggtctttaccgtgcaagaagaagttggc
gttaaaggagcaagaacttctacttatgaaattacgccagattttggaattgcagttgat
gtaacaactgcgggtgattttttagatccccatattaatgcactcgagttaggaaaagga
cctgcaataaaggttatggacggtggaatgataacaaatactgatttgagaaacgaacta
gtcaatattgcaagaaaaaataatattccttaccagcttgaagtaataactggtggaaca
actgatgcgtttgcaatgcaaattacaaaggaaggtgtaaagactgctgctatttcaatt
ccaactcgttatgttcatacacaaggcgaactggctgatattaatgacattaaaaataca
gtggctttgttaaagaacttcattgaaaaataa

DBGET integrated database retrieval system