KEGG   Caldisericum exile: CSE_09410Help
Entry
CSE_09410         CDS       T01804                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cex  Caldisericum exile
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cex00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CSE_09410 (malQ)
Enzymes [BR:cex01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CSE_09410 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(923651..925138)
Genome map
AA seq 495 aa AA seqDB search
MRGKNIRKSGVLVHITSLPSKFGIGDVGYSAKNFIDLLKNSSQKLMQILPIGPTEPFFDN
SPYHSVSAFAINPLFISLEKLKEEGLLESNLSDYEVVESNIVPFGEVIENKFRAFGVAFK
NFKESDEFEKFCAENSFWLDDYANFTALKKRFGNKPWQEWPLEFKNRDKVALNLAKDILK
DEIRFVKFLQFIAYKQLLEMKAYANENGIEIIGDLPIYVDLDSPDVWANRELFNLNEEGY
PIKVAGVPPDYFNENGQLWGNPVYNWDKHKEIGFEWWIRRISHLLKFVDIVRIDHFRGFV
AYYAIDAGRENAKVGDWIRVPVYEFFDAIKNHFPSMPFIAEDLGLITEDVVEVIEHYNIP
NMRILQFAFDGSPENGYLPHNYKNPTVVYTGTHDHNTTVGWFKYELTEKGKEYLEKYLGK
AITIQTINFDLIRLAHSSIAQFSIVPVQDVLGLDERFRVNTPGTSTGNWRFKLKFSDIDE
EKFLQLKEITEVYGR
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgagaggaaaaaatattcgaaaaagtggagttttagttcacattacaagtttgccaagt
aagtttggaattggtgatgttggatattcagcaaagaattttattgatttacttaaaaac
tcatctcaaaaattaatgcagattttaccgataggcccaacggagcctttctttgacaat
tcgccgtatcactcagtatccgcttttgcaataaatccgttgtttataagtcttgaaaaa
cttaaagaagaaggacttcttgaaagcaatctttctgattacgaagttgtggaatctaat
attgttccctttggagaagttattgagaataaattcagggcctttggtgttgcgttcaaa
aattttaaagaaagtgatgaatttgagaaattttgtgctgagaattctttttggttagat
gattatgcaaatttcacagcattaaaaaagagatttggaaataaaccgtggcaagagtgg
cctttagagtttaaaaatagagacaaagttgccttaaatcttgcaaaagatattttaaaa
gatgaaattcgttttgttaaatttttacaatttatcgcatacaaacagctcttggagatg
aaagcctatgcaaatgaaaacggaattgaaataattggagatcttccaatatacgttgat
ctcgatagccctgatgtgtgggcaaatagagagttatttaacttaaatgaggaagggtat
cctataaaagttgcaggagttccgccggattacttcaatgaaaatggacaattatggggt
aatcctgtttataattgggataagcataaagaaataggttttgaatggtggataagaaga
atttctcatcttttaaaatttgtagacatcgtaaggattgatcactttagaggatttgtt
gcatattacgcaatagatgcagggcgagaaaatgcaaaagttggcgactggataagggtt
cctgtgtatgaattttttgacgccattaaaaatcattttccatcgatgccttttatagca
gaagatcttggactaattacagaggatgttgtagaggtaattgagcactacaatattcca
aatatgaggattcttcaatttgcatttgatggatctcctgaaaacgggtatcttccacat
aattataaaaatccaacggttgtgtatacaggcacacatgatcataacacaacagtgggt
tggtttaaatatgaacttacagaaaaaggcaaggagtatcttgaaaaatacttggggaag
gcaataacgattcaaacaattaattttgatttaataagacttgctcactcttctattgca
caattttcaattgttcctgtccaggatgttttgggtctcgatgaacgctttagagtgaat
actccaggcacatcgacgggaaattggcgcttcaaattaaaatttagcgatatagatgag
gaaaaatttttacaactaaaggaaattacagaagtttacggacggtga

DBGET integrated database retrieval system