KEGG   Caldisericum exile: CSE_10060Help
Entry
CSE_10060         CDS       T01804                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cex  Caldisericum exile
Pathway
cex00010  Glycolysis / Gluconeogenesis
cex00052  Galactose metabolism
cex00500  Starch and sucrose metabolism
cex00520  Amino sugar and nucleotide sugar metabolism
cex00521  Streptomycin biosynthesis
cex01100  Metabolic pathways
cex01110  Biosynthesis of secondary metabolites
cex01120  Microbial metabolism in diverse environments
cex01130  Biosynthesis of antibiotics
cex01200  Carbon metabolism
Module
cex_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cex00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CSE_10060 (glk)
   00052 Galactose metabolism
    CSE_10060 (glk)
   00500 Starch and sucrose metabolism
    CSE_10060 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CSE_10060 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CSE_10060 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CSE_10060 (glk)
Enzymes [BR:cex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CSE_10060 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase
Motif
Other DBs
NCBI-ProteinID: BAL81132
UniProt: I0GK45
Position
complement(982618..983556)
Genome map
AA seq 312 aa AA seqDB search
MNEFIGVDLGGTKIFGVALNDNFEILSSKRVLTGDVNDLSSIIEKVINLINELKTENTKS
VGFGVAGFVDFKNGIIHGSPNIPALKEVNLKEIVERETGLYTFIDNDAKTGALAELYVGS
DKNLKDFLFIAFGTGIGSAIVTNGSIVRGKDNLAGEIGHITLDPNGPLCTCGKYGCFEAF
ASGPSIRRIYLERINKTTKSPLLESINYNFDLIDTPLIFEFINTDPIAKEVLYETAMHIG
HGLSIVVNLLNPEKIIIGGGMGQSLKLIFNDIMDSFYKNTLKIPGKSVQFEFSTLGNVGV
ALGSGILASINI
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaatttattggagttgatttaggtggaacaaagatatttggggtagcattgaat
gataattttgaaatactttcaagtaaaagagttctaacaggcgatgtaaatgatctatcc
tcaataattgaaaaggttatcaatctcattaacgaactgaaaacagaaaatacaaaaagt
gtaggttttggagttgctggtttcgttgattttaagaatggtattatacacggatcccca
aatattcctgcgttaaaggaagtcaatttaaaagaaattgttgagagagaaacaggtttg
tatacgtttatcgataacgatgcaaagactggtgcacttgcagaactgtatgtgggaagt
gacaaaaatttaaaagattttttgtttattgctttcggcactggaattggctctgcgata
gttactaacggatccattgtacgcgggaaagacaaccttgcaggagaaatagggcatatt
actcttgatccaaatggacccctttgcacatgtggaaaatatggttgctttgaggcattt
gcatctggtccatcaataagaagaatttatcttgagcgcatcaataaaactaccaaatcg
ccattacttgaaagtattaattataattttgaccttattgatacacctcttatatttgag
tttataaatacagacccaattgcaaaagaagttctatatgaaacagcaatgcatattggt
catggtctttcaatagttgtaaatcttttgaatccggaaaagataataattggtggaggg
atgggtcaatcattaaaacttatctttaacgacattatggatagtttttataagaataca
cttaaaattcctggaaaaagtgttcagtttgaattttcaaccctgggcaatgttggtgtt
gccttgggaagtggaattcttgcatcaattaacatttag

DBGET integrated database retrieval system