KEGG   Caldisericum exile: CSE_10200Help
Entry
CSE_10200         CDS       T01804                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cex  Caldisericum exile
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cex00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CSE_10200 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CSE_10200 (sucC)
   00640 Propanoate metabolism
    CSE_10200 (sucC)
   00660 C5-Branched dibasic acid metabolism
    CSE_10200 (sucC)
Enzymes [BR:cex01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CSE_10200 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1000678..1001814)
Genome map
AA seq 378 aa AA seqDB search
MNLQEYQSREFFERFGIQVVVGDVASNPEEALGIAKKIGLPVVLKAQVLVGGRGKAGGVK
VAKTEEDVLKLAGEILSMEIKGLKVRKLLVAKAVNIVKEFYVGFTVDRGSKKNVLIVSEA
GGVDIEEVAKNTPEKIYKIYIDPIMGLFSYEAKKASLLLTRDMNIAPKIADIIERLYKVY
ISLDANLAEINPLAVVDNSVVLALDAKIVIDDNAMFRHPELEDLREPTEEEKLELEAKSK
GFTYIKLNGNIGCLVNGAGLAMATMDLIKLFGGEPANFLDIGGSSSPDKVANAIEMITRD
KNVKAILINIFGGITRCDDVANGLLKALDMTKVDVPIVVRLTGTNEDKAKEILKDTPLIY
TDSMVEGVKKVVEVANAR
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcaggagtatcaatcaagagaatttttcgaaagattcggcatccaagtagtt
gttggggatgttgcaagcaatccggaagaagcattaggaattgcaaaaaaaattgggcta
cctgttgttttgaaggcccaggttttagttggaggtcgtggaaaagcaggtggtgtaaaa
gttgcaaaaactgaagaagatgttttaaaacttgcaggcgaaattctttcaatggaaata
aaaggtttaaaggttaggaaattacttgtcgcaaaagcagttaatatagttaaggaattt
tacgttgggtttaccgtggatagaggaagcaaaaagaatgttttaattgtatcagaagca
ggcggtgttgatattgaagaggttgcaaaaaatactcctgaaaaaatctacaaaatttat
attgatcctattatgggtcttttttcttatgaagcaaagaaggcctctttgttgcttaca
agggatatgaatattgcacccaagatagcagacatcattgagagattatataaggtttat
atttcacttgatgcgaatcttgccgagattaatcctcttgcagtggtagataacagcgtt
gttttagcacttgatgcaaaaattgttattgatgacaatgcgatgtttagacatcccgaa
cttgaggaccttagagagcctacagaagaagagaagcttgaacttgaagcaaagtcaaaa
ggtttcacttacataaagttgaatggaaatattggttgtcttgtaaacggagcaggtctt
gcaatggctacgatggaccttataaagctctttggtggagagcctgcaaacttccttgat
attggaggttcatcttctcccgataaagttgcaaatgcaattgaaatgattacacgagat
aaaaacgttaaggcgattcttataaacatttttggtggaatcactcgctgtgatgatgtg
gcaaacggtcttctaaaagcacttgatatgacaaaggttgatgttccgatagttgtaagg
cttactggcacaaacgaggacaaagcaaaagagatacttaaagatacacctcttatttat
accgattcaatggttgaaggtgttaaaaaagttgttgaagttgcaaatgcgaggtga

DBGET integrated database retrieval system