KEGG   Caldisericum exile: CSE_10860Help
Entry
CSE_10860         CDS       T01804                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cex  Caldisericum exile
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cex03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1061161..1061724
Genome map
AA seq 187 aa AA seqDB search
MIKKLRGVIVEKDEDSVILDVKGIGFEVFVAHAETFEKGKDYEVYIFEDIKENEINLFGF
LTKEELNFFKLIINKISGVGPKKALDILSSLSLDEITNAIKKGDHTPFLKVKGLGEKTAK
RIVLEIGGELKKLEETKDENLEIITESLISLGFEKNRVKEVVKNLDKTKPIEEMMKEGIK
KLSNEKH
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaactcagaggcgtaattgtagaaaaagatgaagactcggttatacttgac
gtaaaaggtatcggttttgaagtctttgtagcacatgcagaaactttcgaaaagggaaaa
gattatgaggtttacatttttgaagatataaaggaaaacgaaataaatttatttggattt
ttaacgaaagaagaacttaacttttttaaacttataatcaacaaaatatctggtgtcggc
cccaaaaaggcactggatatattatcatcactttcacttgatgagataactaatgccatt
aaaaagggggatcatacgccattcttgaaagtcaaaggacttggcgaaaaaaccgctaaa
agaatcgtccttgaaattggtggagaacttaagaaacttgaagagacaaaagatgaaaat
cttgaaattataactgagtctcttatatctttaggttttgaaaagaatagagttaaagaa
gttgtgaaaaatcttgataaaacaaaaccaatcgaagaaatgatgaaagaaggtataaag
aagttgagcaatgaaaagcattag

DBGET integrated database retrieval system