KEGG   Caldisericum exile: CSE_12190Help
Entry
CSE_12190         CDS       T01804                                 

Definition
alcohol dehydrogenase (EC:1.1.1.-)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cex  Caldisericum exile
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cex00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CSE_12190
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CSE_12190
  Lipid metabolism
   00071 Fatty acid degradation
    CSE_12190
  Amino acid metabolism
   00350 Tyrosine metabolism
    CSE_12190
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CSE_12190
   00626 Naphthalene degradation
    CSE_12190
Enzymes [BR:cex01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CSE_12190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1180906..1181916)
Genome map
AA seq 336 aa AA seqDB search
MKAMFIEKIGRLEETSLVLREVEVPTPKDNEVLLKVSYCGVCHTEIDEIEGRRMPKIPVI
PGHEVVGYVVEKGKNVTNLEIGDRVGVAWIKHACGKCEYCKSGRENLCNEFVATGADEDG
GYAEYMVVESSFAYKLKENLQDETTAPILCAGAVGFRAYKLAEIKDGETVALFGFGASNH
IVYRYIRYLNPSSKIIVFVRKLGDNATKLAEELKADYIFETFSDIPIRYDKAIDTTPSGS
VIPYALKYLNKGGLVVVNAIRKETPIDAFDFTLIWGERSVKSVANVTREDVENALKLASV
IPIVPKVTVFPLEKAQEALLSVKHGKIQGAAVLKIS
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaatgtttattgaaaaaattggaagattagaggaaacatctcttgttttaaga
gaggttgaagtccctacacctaaggataatgaagtcttgttaaaagtttcttattgtggt
gtgtgccatactgagattgacgaaattgaagggcgaaggatgcctaaaattcctgttatc
ccagggcacgaagttgtaggttatgttgttgaaaaagggaaaaatgttacaaatcttgaa
attggcgatagagttggtgttgcctggataaagcatgcctgcggtaagtgtgaatattgt
aagagtggcagggaaaatctttgtaacgaatttgttgcaactggagcagatgaagacggt
ggctatgcagagtatatggttgttgaaagtagttttgcttataaattgaaagaaaacttg
caagacgaaacaactgccccaattttatgtgcaggtgcagttggctttagggcgtataaa
cttgcagaaattaaagatggagaaacagttgcactttttggttttggcgcatcaaatcat
atcgtttatagatatattaggtatcttaatccgtcttcaaaaattatagtttttgtgcga
aaacttggtgataacgcaacaaagttagcagaggagttaaaagcagattatattttcgaa
acctttagtgatattcccataagatacgataaagcaattgatacaacaccttcgggaagt
gtgattccttatgccctgaaataccttaataaagggggccttgttgttgtaaatgcaata
agaaaagagaccccaattgatgcgtttgactttacccttatttggggagaaaggtccgtt
aagagtgttgcaaatgttacaagagaagatgtagaaaatgctctaaaacttgcttcagtt
attcctattgttccaaaggttacagtttttcccttagagaaagcacaggaagcgcttctc
tcggttaagcacggaaaaattcaaggtgcggcggtattgaaaatttcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system