KEGG   Caldisericum exile: CSE_12190Help
Entry
CSE_12190         CDS       T01804                                 

Definition
(RefSeq) alcohol dehydrogenase (EC:1.1.1.-)
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cex  Caldisericum exile
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cex00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CSE_12190
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CSE_12190
  Lipid metabolism
   00071 Fatty acid degradation
    CSE_12190
  Amino acid metabolism
   00350 Tyrosine metabolism
    CSE_12190
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CSE_12190
   00626 Naphthalene degradation
    CSE_12190
Enzymes [BR:cex01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CSE_12190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1180906..1181916)
Genome map
AA seq 336 aa AA seqDB search
MKAMFIEKIGRLEETSLVLREVEVPTPKDNEVLLKVSYCGVCHTEIDEIEGRRMPKIPVI
PGHEVVGYVVEKGKNVTNLEIGDRVGVAWIKHACGKCEYCKSGRENLCNEFVATGADEDG
GYAEYMVVESSFAYKLKENLQDETTAPILCAGAVGFRAYKLAEIKDGETVALFGFGASNH
IVYRYIRYLNPSSKIIVFVRKLGDNATKLAEELKADYIFETFSDIPIRYDKAIDTTPSGS
VIPYALKYLNKGGLVVVNAIRKETPIDAFDFTLIWGERSVKSVANVTREDVENALKLASV
IPIVPKVTVFPLEKAQEALLSVKHGKIQGAAVLKIS
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaatgtttattgaaaaaattggaagattagaggaaacatctcttgttttaaga
gaggttgaagtccctacacctaaggataatgaagtcttgttaaaagtttcttattgtggt
gtgtgccatactgagattgacgaaattgaagggcgaaggatgcctaaaattcctgttatc
ccagggcacgaagttgtaggttatgttgttgaaaaagggaaaaatgttacaaatcttgaa
attggcgatagagttggtgttgcctggataaagcatgcctgcggtaagtgtgaatattgt
aagagtggcagggaaaatctttgtaacgaatttgttgcaactggagcagatgaagacggt
ggctatgcagagtatatggttgttgaaagtagttttgcttataaattgaaagaaaacttg
caagacgaaacaactgccccaattttatgtgcaggtgcagttggctttagggcgtataaa
cttgcagaaattaaagatggagaaacagttgcactttttggttttggcgcatcaaatcat
atcgtttatagatatattaggtatcttaatccgtcttcaaaaattatagtttttgtgcga
aaacttggtgataacgcaacaaagttagcagaggagttaaaagcagattatattttcgaa
acctttagtgatattcccataagatacgataaagcaattgatacaacaccttcgggaagt
gtgattccttatgccctgaaataccttaataaagggggccttgttgttgtaaatgcaata
agaaaagagaccccaattgatgcgtttgactttacccttatttggggagaaaggtccgtt
aagagtgttgcaaatgttacaagagaagatgtagaaaatgctctaaaacttgcttcagtt
attcctattgttccaaaggttacagtttttcccttagagaaagcacaggaagcgcttctc
tcggttaagcacggaaaaattcaaggtgcggcggtattgaaaatttcttaa

DBGET integrated database retrieval system