KEGG   Caldisericum exile: CSE_12500Help
Entry
CSE_12500         CDS       T01804                                 

Gene name
fucA
Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cex  Caldisericum exile
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cex00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CSE_12500 (fucA)
Enzymes [BR:cex01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     CSE_12500 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1204817..1205449
Genome map
AA seq 210 aa AA seqDB search
MKRQIKEDIAAIGRRLYEHQLNGSYGGNFSVREEEFIYITPSGVPKDELDYSDILVIDFS
GNVVEGEGKPSSEILFHIKIYKVRPDVNAIIHAHPPYATGFAIANSSIPNNVHEESTLIL
GDVPVIPYEITSSKELAENIGKAIQDHNALLLANHGALTVGDTLERAFRRMEELENLCKM
LTVANLLGGAKPIPQDKLENLLTLSLTLHF
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaagagacaaataaaagaagatatagcagcgattggaagaagactgtatgagcatcaa
cttaacggaagttacggtggaaatttttcagtaagagaagaggaatttatatacataact
ccttcaggtgttcccaaagacgaattagactactcagatattcttgtaattgatttcagt
ggaaacgtcgttgaaggtgaagggaaaccttcttcggaaattctttttcacataaaaatt
tataaagttcgtcctgacgtaaacgcaataatacatgcccacccaccatatgcaacaggt
tttgctattgcaaactcttcaattccaaacaatgtccacgaagaatctactctaatattg
ggagatgtgcctgtaattccttatgagataacttcctcaaaagaacttgcagaaaatatt
ggtaaggcaatacaagaccataacgctctccttcttgcaaaccacggtgcacttaccgtt
ggggacacactggaaagagcatttagaagaatggaagaactcgaaaatctgtgcaagatg
ctaactgttgcaaaccttcttggtggagcaaagccaattcctcaagataaacttgaaaat
ctcctgactttatcacttactcttcatttttga

DBGET integrated database retrieval system