KEGG   Caldisericum exile: CSE_13090Help
Entry
CSE_13090         CDS       T01804                                 

Definition
putative esterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
cex  Caldisericum exile
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1267149..1267895
Genome map
AA seq 248 aa AA seqDB search
MSEIWEEGKPFSSIGNKDIGVLVLQGFTGTVGSIIYLAKFLAVQGYHVEAPRLSGHATKW
EDLNKVKYSDWLNDVEIAYKKLQERTKNIFVAGLSMGGALTLYMLERHPEIKGGALINHI
VVLNDPKVKLLPILSIFVKSMPAISSDIKDPTVKEPAYDRTPTRGAYEMVKLLNIVQKDL
KKITQPLLILKSREDHVVPLENVDYTLNNVSSKDVKVIYLENSYHVATMDYDKDLINNYV
KEFIETYL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaatttgggaggaaggaaagccttttagtagtattggaaataaagatattggc
gtgctcgttttgcagggattcacggggactgttggaagcataatttatcttgctaagttt
cttgcagtgcagggttaccacgttgaggcaccacgtttaagcggacatgcaaccaaatgg
gaagacctcaacaaagtaaaatacagtgattggcttaacgatgttgaaattgcctacaaa
aaacttcaagaaagaactaagaacatttttgttgctggactttcaatgggtggtgcgcta
actctttacatgcttgagcgtcaccctgaaataaagggaggtgcccttattaaccatatt
gttgttctaaatgacccaaaggtaaagcttctcccaattttaagtatctttgtaaagtca
atgcctgcaattagctcagatataaaagatccaaccgttaaagaacctgcatacgacagg
acaccaacacgtggagcatatgaaatggtaaaacttctaaatattgtgcaaaaagacctt
aaaaaaataacacaaccactacttattttgaagtcaagagaggaccacgttgtgccactt
gaaaatgtagattatacgcttaacaatgtttcctctaaggatgtaaaagttatctatctt
gaaaactcataccacgttgcaacaatggactacgacaaagaccttattaataattatgta
aaggagtttattgaaacatatctatag

DBGET integrated database retrieval system