KEGG   Caldisericum exile: CSE_13580Help
Entry
CSE_13580         CDS       T01804                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cex  Caldisericum exile
Pathway
cex00900  Terpenoid backbone biosynthesis
cex01100  Metabolic pathways
cex01110  Biosynthesis of secondary metabolites
cex01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cex00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CSE_13580 (ispE)
Enzymes [BR:cex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     CSE_13580 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: BAL81484
UniProt: I0GL47
Position
1318288..1319136
Genome map
AA seq 282 aa AA seqDB search
MTMEAKAYAKLNLTLEITGELGEYHTIESVFQKISLFDVVSVKLGKSDSIIFSESIRNIT
STVHKALELFKKKANVKENFEIYVKKNIPMGSGLGGGSADGAITLLLLNAMFKNILSKSD
LYEIAKEVGSDVPFFLDSNTAWVKGIGDIVQELPNLKELYFVLVHPKFHFKTKEMYAMFH
DYGKYSDGTRTLTLVELIKKGNYTAKDIDKLCYNDFEMMLLEKSEKFVEFKNILETIAEV
KFHLTGSGSTVFAIFDTKKEAEKVKNTLDKMKFNTDLVSSNI
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgactatggaagcaaaagcatatgcaaagttaaatttaacacttgaaattacgggtgaa
ttaggtgaataccacaccattgaatctgtatttcagaaaataagtctttttgatgttgtt
tcagtcaaattgggaaaatcagattcaataatattctcggagtccattagaaatattact
tcaactgttcacaaagcgcttgaattgtttaagaaaaaggcaaacgtgaaagaaaatttc
gagatctatgtgaagaaaaatatcccaatgggtagtggacttggaggcggaagtgcagat
ggcgcaataacactacttctccttaatgctatgttcaaaaatatcctttcaaaaagtgat
ctctacgaaatagcaaaggaagtcggttccgatgtgccattctttctcgattcaaacaca
gcatgggttaagggtatcggtgatattgtgcaagaattgccaaacctaaaagagttatat
tttgttttggttcatccaaaatttcacttcaagacaaaagaaatgtatgctatgtttcat
gattatggaaaatactcagatggaacaaggacattaactttagttgaattaattaaaaaa
ggaaattacacagcaaaagacattgataaactttgctataacgattttgaaatgatgctt
ttagagaaatccgaaaagttcgttgaatttaagaatattcttgaaacaattgcggaagta
aaatttcaccttacaggatcagggtctactgtgtttgcaatctttgatacaaaaaaggag
gcggaaaaagttaaaaacactcttgataaaatgaaattcaacacggaccttgtaagttct
aatatataa

DBGET integrated database retrieval system