KEGG   Caldisericum exile: CSE_14840Help
Entry
CSE_14840         CDS       T01804                                 

Definition
putative 6-phosphofructokinase (EC:2.7.1.-)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cex  Caldisericum exile
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cex00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CSE_14840
   01230 Biosynthesis of amino acids
    CSE_14840
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CSE_14840
   00030 Pentose phosphate pathway
    CSE_14840
   00051 Fructose and mannose metabolism
    CSE_14840
   00052 Galactose metabolism
    CSE_14840
  Energy metabolism
   00680 Methane metabolism
    CSE_14840
Enzymes [BR:cex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CSE_14840
Protein phosphatases and associated proteins [BR:cex01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CSE_14840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1437200..1438225)
Genome map
AA seq 341 aa AA seqDB search
MKRIGIVCDGGDAPGINTAIRAIARASFEKEYEVLGFIDGFHGLIENDVKIITKSSVSGI
LALGGSILGISRFNPYRDPKYVEAIRENFKRNSLTLLVFIGDRDTVTIAKRLADDGIPSI
VIPKTIDNDVYGTDYSIGFDTAVSVIAQSLDNLHATASAHHRLMVVETMGRETGWLALFG
GLAGGADYIVIPEVPFTIEEIAAHVEKRKREGKNFSIVVVAEGVVLPDEDKSKFEFDEFG
HKVNAKRMVGYRLASKLEELTHLKSRVMILGYLQRGGIPTNSDRILATRFGVEAVNLVGL
GISNVVLGVKNGEVITTPYDEAYDKIHTADTKYYELARIFF
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaataggaattgtatgcgatggtggagatgcacctggtattaacactgcaata
agggccattgcgagggcaagttttgagaaagaatacgaggttttaggttttattgatggt
ttccatggccttattgaaaatgatgtaaaaatcattacaaaatcttctgtttcggggatt
cttgctctgggtggaagcattcttggaatttcaaggtttaatccatatagagatcctaaa
tatgttgaagcaataagggaaaacttcaaaaggaattcgctaactttgcttgtattcatt
ggtgatagagatacagtcaccattgcaaagaggcttgctgatgatggaattccatcgatt
gtaattccaaagacaattgataacgatgtatacggaactgactattccattggatttgac
acagcagtttctgtaattgctcagtccctcgataatcttcatgcaacagcctcagcgcac
cacagacttatggtagtggaaacaatgggaagggagacagggtggcttgcgctatttggt
ggtcttgcaggaggtgcagattacattgtaattccagaggttccttttacaattgaagag
atcgcagcacatgttgaaaaaagaaaaagagaaggaaagaatttctcgatcgtagttgtt
gcagaaggcgttgtattgcctgatgaggataaaagtaaattcgaatttgatgaatttggg
cacaaggtgaatgcaaagagaatggttggttataggcttgcttcgaaacttgaggaactt
acacaccttaaatcgagagtgatgatattagggtatttgcagagagggggtatccctaca
aatagtgacaggattcttgcaacaagatttggggttgaagcagttaatcttgtgggtttg
ggaatctcaaatgtggtgcttggggttaaaaatggtgaagtaattacaacaccgtatgat
gaagcatacgacaaaatccatacggcggacaccaagtattatgagcttgcaagaatattc
ttctaa

DBGET integrated database retrieval system