KEGG   Canis familiaris (dog): 100683291Help
Entry
100683291         CDS       T01007                                 

Gene name
MYL7
Definition
(RefSeq) myosin light chain 7
  KO
K12754  myosin regulatory light chain 7
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04510  Focal adhesion
cfa04670  Leukocyte transendothelial migration
cfa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100683291 (MYL7)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100683291 (MYL7)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    100683291 (MYL7)
Cytoskeleton proteins [BR:cfa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100683291 (MYL7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9
Motif
Other DBs
NCBI-GeneID: 100683291
NCBI-ProteinID: XP_003435426
Position
Un
AA seq 93 aa AA seqDB search
GPINFHVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAE
VEQMFALTPMDLAGDIDYKSLCYIITHGDEKEE
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
ggtcccatcaacttccacgtcttcctcacgctcttcggggagaagctcaatgggacggac
ccggaggaagccatcctgagtgccttccgcatgtttgaccccagcggcaagggtgtggtg
aacaaggatgagttcaagcagcttctcctgacccaggctgacaagttctctccggcggag
gtggagcagatgtttgccctgacgcccatggacctggcaggggacatagactacaagtct
ctgtgctacatcatcacccacggggatgagaaagaggagtga

DBGET integrated database retrieval system