KEGG   Canis familiaris (dog): 100683291Help
Entry
100683291         CDS       T01007                                 

Gene name
MYL7
Definition
myosin, light chain 7, regulatory
Orthology
K12754  
myosin regulatory light chain 7
Organism
cfa  Canis familiaris (dog)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100683291 (MYL7)
  Cellular commiunity
   04510 Focal adhesion
    100683291 (MYL7)
   04530 Tight junction
    100683291 (MYL7)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    100683291 (MYL7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 93 aa AA seqDB search
GPINFHVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAE
VEQMFALTPMDLAGDIDYKSLCYIITHGDEKEE
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
ggtcccatcaacttccacgtcttcctcacgctcttcggggagaagctcaatgggacggac
ccggaggaagccatcctgagtgccttccgcatgtttgaccccagcggcaagggtgtggtg
aacaaggatgagttcaagcagcttctcctgacccaggctgacaagttctctccggcggag
gtggagcagatgtttgccctgacgcccatggacctggcaggggacatagactacaagtct
ctgtgctacatcatcacccacggggatgagaaagaggagtga

DBGET integrated database retrieval system