KEGG   Canis familiaris (dog): 100683352Help
Entry
100683352         CDS       T01007                                 

Gene name
PFN2
Definition
profilin 2
Orthology
K05759  
profilin
Organism
cfa  Canis familiaris (dog)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:cfa04015]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:cfa04810]
Human Diseases; Infectious diseases; Salmonella infection [PATH:cfa05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
23
AA seq 107 aa AA seqDB search
MPAGGVFQSITPVEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQ
GGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgccggccgggggcgtcttccagagcatcacgccagtagaaatagatatgattgtagga
aaagaccgggaaggtttctttaccaacggtttgactcttggcgcaaagaagtgctcggtg
atcagagatagcctatacgtcgacggtgactgcacaatggacatccggacaaagagtcaa
ggtggggagccaacatacaacgttgctgtcggcagagctggtagagtcttggtctttgta
atgggaaaagaaggggtccatggaggcggattgaataagaaggcatactcaatggcaaaa
tacttgagagactctgggttctag

DBGET integrated database retrieval system