KEGG   Canis familiaris (dog): 100683352Help
Entry
100683352         CDS       T01007                                 

Gene name
PFN2
Definition
profilin 2
Orthology
K05759  
profilin
Organism
cfa  Canis familiaris (dog)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100683352 (PFN2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100683352 (PFN2)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100683352 (PFN2)
Exosome [BR:cfa04147]
 Exosomal proteins
  Proteins found in most exosomes
   100683352 (PFN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
23
AA seq 107 aa AA seqDB search
MPAGGVFQSITPVEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQ
GGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgccggccgggggcgtcttccagagcatcacgccagtagaaatagatatgattgtagga
aaagaccgggaaggtttctttaccaacggtttgactcttggcgcaaagaagtgctcggtg
atcagagatagcctatacgtcgacggtgactgcacaatggacatccggacaaagagtcaa
ggtggggagccaacatacaacgttgctgtcggcagagctggtagagtcttggtctttgta
atgggaaaagaaggggtccatggaggcggattgaataagaaggcatactcaatggcaaaa
tacttgagagactctgggttctag

DBGET integrated database retrieval system