KEGG   Canis familiaris (dog): 100683370Help
Entry
100683370         CDS       T01007                                 

Definition
(RefSeq) thymosin beta-4
  KO
K05764  
thymosin, beta 4
Organism
cfa  Canis familiaris (dog)
Pathway
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100683370
Cytoskeleton proteins [BR:cfa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Thymosin
     100683370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 44 aa AA seqDB search
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaacccgatatggctgagattgagaaattcgataagtcgaaattgaagaag
acagaaacgcaagagaaaaatccactgccttcgaaagaaacgattgaacaggagaagcaa
gcaggcgaatcgtaa

DBGET integrated database retrieval system