KEGG   Canis familiaris (dog): 100683511Help
Entry
100683511         CDS       T01007                                 

Gene name
UNC13B
Definition
(RefSeq) unc-13 homolog B
  KO
K15293  
protein unc-13 A/B/C
Organism
cfa  Canis familiaris (dog)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    100683511 (UNC13B)
Membrane trafficking [BR:cfa04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    100683511 (UNC13B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
11
AA seq 1987 aa AA seqDB search
MKRLLQESEEEIMVTLGPPSRLSPDKAKSETMCGIKSKYSGPIESLPEDRSLLPHCGSTA
SAIGGDRDGGLAQHCNFEQQAGSQFPLGSTACASGSGSQDLSSVSITTSCQEPSERNQAK
SLLSRGPHQGCSCEQQEPLGDVVDYIIRELQGISRLQTEIAELQQHLSQVRGSVDEVSSC
VDSVLSEIEGLQVGSSSLAKVCAGEMAQEPHMDRPSEEAILYLYGLPEQDGENTMELVHS
FLAMHLCVNGMQCNRYIKEAYRAGKAPAPRPTVVKLAHLEHRDFILQKSILLQSVGVRIA
TKEEPSWPQCYKNPQKESLSFLQQLQDDNANSLNHHEPLLQMETGDTGPITGASQNQHRE
PQTTEQQGLCFPPKNNFTKPSGVSKPGEEVEGTSGAFRVIGGSLGEMTGREASLSTFHQF
EEPSPVLISGEEGSGKPQVLKQSSQGFEACSIAKRENNCSNKSEAGSCLSLSGLLKTEDK
LLACEAGLDILSSKQLEDLLTDKSKRFATLSRDRMMEEIIIGPETFSDMVHIDLNEEEEH
ATQVLKDVFEKSSCGLVGLQEDEDVEIKFYKSKLGRAINHFRSALQGVFQKLENSGSISP
EDLESNESGSQSENSDRLLGTMSSEGAQDFSVESPGSQESESLLSMVSGGVGISTQRDQT
FQDPSNFSLASTSLPIAYSLPGFSLAPCLGSETCSRPESPKQGRLSLEQVCAETVYLNKC
INNFKNVLREKRLRQKKLLHELVQKANHLSVEDIHSERKRGAIQIPDDGHPSLPQWLPEG
PAGGLYGIDSMPDLRRKKPLPLVSDLAMSLVQSRKAGITSAMATRTSLKDEELKSHVYKK
TLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCSECGVKCHEKCQDLL
NADCLQRAAEKSSKHGAEDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFTVSKVAHVQQ
MKTVKQSVLDGTSKWSAKITITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIFGNL
NPVWEEKFHFECHNSSDRIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEM
DVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHVQYTCLHENLFHYLTDIQGSGGV
LIPEARGDDAWKVYFDETAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMST
LLANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSTYRNNFPAGS
PERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLY
SRQYQLKQELPPEEQGPSIRNLDFWPKLITLIVSIIEEDKNSYTLVLNQFPQELNVGKVS
AEVMWQLFAQDMKYALEEHEKDRLCKSADYMNLHFKVKWLHNEYVRDLPALQGQVPEYPV
WFEQFVLQWLDENEDVSLEFLRGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEII
RKLECPDPNILAHYMRRFAKTIGKVLMQYANILSKSFPDYCTKEKMPCILMNNMQQLRVQ
LEKMFEAMGGKELDPEAADSLKELQVKLNTVLDELSMVFGNSFQVRIDECVRQMADILGQ
VRGPGNASPNARASVAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKRVLKELWRVVMNT
MERMIVLPPLTDQTGTQLIFTAAKELSHLSKLKDHMVREETRSLTPKQCEVLDLALDTIK
QYFHAGGNGLKKTFLEKSSDLQSLRYALSLYTQTTDTLIKTFVRSQTAQVHDGKGIRFTA
NEDIRPEKGSGVDDPVGEVSIQVDLFTHPGTGEHKVTVKVVAANDLKWQTAGMFRPFVEV
TMVGPHQSEKKRKFTTKSKSNNWAPKYNETFHFLLGNEEGPEAYELQICVKDYCFAREDR
VLGLAVMPLRDVAAKGSCACWCPLGRKIHMDETGMTILRILSQRSNDEVAREFVKLKSES
RSMEEGS
NT seq 5964 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgattgttgcaagagtcagaggaagaaatcatggtcaccctgggacccccctcc
aggctttccccagataaagctaagtcagagactatgtgtggcatcaagagcaagtactca
ggccccattgaatccttaccagaagatagatccctgctccctcactgtgggtcaacagcc
tcagccattggtggagatagagatgggggcctggcccagcattgcaactttgagcagcag
gccggcagccagtttcctctgggctctacagcctgtgcttcgggatctggctctcaggat
ctctcatctgtcagcattaccacaagctgtcaagagccctcagaaaggaatcaagccaag
tcccttttgtccagaggccctcaccaaggctgcagctgtgaacagcaagagcctttgggg
gatgtagtagactatataatcagagagctacaaggcatcagccgtctccaaactgaaatt
gctgaactgcagcaacacttgagccaagtccggggttctgtggatgaagtgtctagctgt
gtagactcagttctgagtgaaatagaaggcttgcaggtaggcagcagctccctggccaag
gtgtgtgcgggggaaatggcccaggaaccccatatggacagacccagtgaagaagccatt
ctgtatctgtatggacttcctgagcaagatggggaaaataccatggagctggtacacagc
ttcctggccatgcacctctgtgttaatggcatgcaatgcaacaggtacatcaaagaggct
tacagggcaggcaaagctccagcccccaggcctactgttgtgaaacttgcccatctagag
catagagacttcatattgcagaaatccatccttttgcagagtgtaggagtccggattgcc
accaaagaagaaccgagctggccacagtgctataagaatccccaaaaggagtctctgtca
tttttgcaacaacttcaggatgataatgcaaattctttaaaccaccatgagccacttctt
cagatggaaacaggggacacaggacccataacaggagcatctcaaaatcaacacagagaa
cctcaaaccactgagcagcaaggcctttgcttcccacccaagaataatttcacaaagcca
agtggtgtatctaagccaggagaagaagtagaaggaacatcaggagccttccgagttatt
ggtggcagtttgggtgagatgacagggagagaggcttctctgtccaccttccatcaattt
gaggaaccttccccagtattaatctcaggagaggagggttctgggaaaccccaggttttg
aaacagtccagccaaggatttgaagcatgtagtatagcaaaaagagaaaacaactgcagc
aataaaagtgaggctggtagctgcctgtcactgtctggattgctgaagacggaggacaag
ctcctggcctgtgaagctgggcttgatattctgagctcaaagcaactggaggaccttttg
acagataagtccaaaaggtttgcaactctgagccgtgaccgcatgatggaggaaattatc
atagggcctgagactttcagtgacatggttcatattgacttgaatgaagaggaggagcat
gctactcaggtccttaaagatgtctttgaaaagtcatcttgtgggctggtcggtttgcag
gaggatgaagatgtagaaattaaattttacaaaagcaaactgggccgagcaattaaccat
tttcgttcagctctacagggtgtgtttcagaagctggagaatagtgggtccatcagtcct
gaggacctggaaagcaatgagagtggttctcagtcagagaacagtgatagacttcttggt
acaatgagttcagaaggtgcgcaagatttctctgtggagagccctgggagtcaggagagt
gagagcttgctcagtatggtatctggtggagtgggcatttctacacagagagaccaaacc
tttcaggatcctagcaacttctctctggcttctacctccttgcctatcgcatattcattg
ccaggtttttctctggctccatgtctgggaagtgaaacttgttccaggcctgaatctccc
aagcagggcagactaagcctagagcaagtgtgtgcagagactgtctacctcaacaagtgc
atcaacaattttaaaaatgttctgagagagaaaagactgaggcagaaaaaacttttgcat
gagctagtacagaaggcaaaccatctctcagtagaagacatacactcagaaagaaagcga
ggagccattcagattccggatgatggtcacccttctttgccccagtggcttccggaaggg
cctgctggagggctctatggcattgacagcatgccagatctacgcagaaagaaaccattg
ccacttgtcagtgatctggctatgtcattggtccagtcccggaaagcaggaattacttct
gcaatggctacacgtacctctctgaaggatgaagagctgaaatcccatgtgtataagaaa
accctgcaggccttaatctacccaatctcgtgcaccacaccccacaactttgaagtctgg
acagccactaccccaacctactgctatgagtgtgaaggtctgctctggggcattgcccgg
cagggcatgcgctgcagcgagtgtggagtcaagtgccatgagaagtgccaagacctgctc
aacgccgactgcctgcagcgggctgcagaaaagagttctaaacatggagctgaggaccgg
acccagaacataatcatggcgatgaaggaccgcatgaagatccgagagcggaataagcca
gagatctttgaggttatccgagatgtctttaccgtgagcaaagttgcccatgtgcaacag
atgaaaacagtgaagcagagtgtactggatggcacctccaaatggtcagccaaaattacc
atcactgtggtgtgtgcccagggcctacaagccaaggacaagacaggatccagtgaccct
tatgtgactgtgcaagtgggcaaaaccaagaagcgtaccaagactatttttgggaacctg
aatcctgtttgggaagagaagttccattttgagtgccacaactcttctgaccgcattaag
gtacgtgtatgggatgaggatgatgacatcaagtcaagagtaaagcaacggctaaagcga
gagtccgatgatttccttggccaaaccattattgaggttcggacactgagtggcgagatg
gacgtctggtacaacttggagaagaggacagataaatcagctgtctcaggggctatccga
ctgcaaatcagtgtggagatcaagggagaggagaaagtagcgccatatcatgtgcagtat
acgtgtctccatgagaaccttttccattacctcacagacattcagggtagtggaggagtc
ctgatccctgaggctcgcggagacgatgcatggaaggtgtactttgatgagactgcccaa
gaaattgtggatgaatttgccatgcgctatggcatcgagtccatatatcaggccatgacg
cactttgcatgtttgtcatccaagtacatgtgtcctggtgtgcctgcggtgatgagcacc
ttattggccaacatcaatgcctactatgcccatacaactgcctctaccaacgtctctgca
tctgatcgctttgcagcctccaactttgggaaagagagatttgtaaaactactggaccag
ctgcacaactcactgaggattgacctctctacctacaggaataatttccctgctggaagc
cctgagcggcttcaggacttaaagtcaacagtggatttgctgaccagcattactttcttc
agaatgaaggtacaagaactgcagagccctccaagagccagccaagtggtaaaggattgt
gtgaaggcctgtttgaactccacatatgagtatatcttcaacaactgccatgacttgtat
agtcgccagtaccagctgaaacaggagctacctccagaggaacaaggacccagcattcgg
aacctggatttttggcccaaactcatcacgctcattgtgtcaatcatagaggaagataag
aattcctacacactcgttctgaaccagtttcctcaggaattgaatgtgggaaaagtcagc
gcagaagtgatgtggcagctctttgcccaagacatgaaatatgcactggaggagcatgag
aaggaccggctgtgtaagagtgctgactacatgaacctgcacttcaaggtgaagtggctc
cacaatgaatacgtgcgagatctgcctgccctgcaggggcaggtgcctgagtacccagtg
tggtttgagcagtttgttctgcaatggctggatgaaaatgaggatgtgtccctggaattc
ctgcgtggggctctggaacgagataagaaggatgggttccagcagacatcagagcatgca
ctcttttcctgctctgtggtggatgtcttcacacagctcaaccagagctttgagatcatc
cggaagctggagtgcccagaccccaacatccttgcccactacatgaggagatttgctaag
accatcgggaaggtgttgatgcagtatgcaaacatcttatcaaagagcttcccagattat
tgcacaaaggagaaaatgccctgcatcctgatgaacaacatgcagcaactgagggtccag
ctggagaaaatgtttgaggccatgggaggcaaggagttggaccctgaagctgcagacagt
ttgaaggagctgcaggtgaaactgaatacagttctggatgagctcagcatggtatttgga
aacagttttcaggtgcggattgatgagtgtgttcgacaaatggctgacatcctgggccag
gtgcgaggcccagggaatgcatcccccaacgccagggcctctgtggctcaggatgcagat
agtgtgctccggcctctcatggacttcctggatggcaacctcacactctttgccactgtg
tgtgagaagacagtcctgaagcgtgtactgaaggagctctggagggtggtcatgaacaca
atggaaagaatgattgttctgcccccactcactgaccagacgggcacccagctgatcttt
actgctgccaaggagctgagccatctttctaagctcaaggaccacatggtgcgagaggaa
acacggagtctcactccaaagcagtgtgaagtccttgacctcgctctggacactatcaag
caatactttcatgcaggaggtaatgggctgaagaaaaccttcctggagaagagctcagat
ctgcagtctctacgctatgccctgtctctctacacacagaccacagatacactcatcaaa
acctttgtacgctcacagactgcccaggtgcatgatgggaaaggtattaggtttactgct
aatgaggacattcggccggaaaagggatctggtgtggatgatcctgtgggagaagtctct
attcaggtggacttgtttacacatcctggaactggggagcacaaggtcacagtgaaagtg
gtagctgccaatgacctcaagtggcagacagcgggtatgttccggccctttgtggaagtg
accatggttggcccacaccaaagtgaaaagaagaggaagttcacaaccaagtcaaaaagc
aacaactgggctcccaagtacaatgagacatttcacttcctcctgggaaatgaagaaggg
ccagaagcctatgaattgcaaatatgtgtgaaggattactgctttgcccgtgaggatcgt
gttttggggctggctgtgatgcctctgagggatgtagcagccaagggcagctgtgcttgc
tggtgtcccttgggccggaagatccacatggatgagacaggcatgactattctccggatt
ctatctcaaaggagcaatgacgaagtggctcgagagtttgtgaagctcaaatcggagtct
cgttccatggaagaggggagctga

DBGET integrated database retrieval system