KEGG   Canis familiaris (dog): 100684058Help
Entry
100684058         CDS       T01007                                 

Gene name
STAMBP
Definition
STAM binding protein
Orthology
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
cfa  Canis familiaris (dog)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100684058 (STAMBP)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100684058 (STAMBP)
Peptidases [BR:cfa01002]
 Metallo Peptidases
  Family M67
   100684058 (STAMBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 424 aa AA seqDB search
MSDHGDVSLPPEDRVRALSQMGSTVEINEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAF
ILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKEELLKRYTKEYIE
YNEEKKREAEELARNVAIQQELEKERQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLK
IVQEFGKVDPGLGGPLVPDLEKPSPDIFPPAPVASAQPADCNTAVRPAKPPVVDRSLKPG
ALSNSESTPTIDGLRHVVVPERLCPQFLQLASANTARGVETCGILCGKLMKNEFTITHVL
IPKQSAGSDYCHTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLP
ESIAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTI
TDLR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccatggagatgtgagccttccgcccgaagaccgggtgagagccctgtcccag
atgggtagcacagtggagataaatgaagacattccaccccgacggtacttccgctctgga
gtcgagattatccgaatggcatccatttactctgaggaaggcaacattgaacatgccttc
atcctctataacaagtatatcacgctctttattgagaagctcccaaagcatcgagattac
aaatcagctgtcattcctgagaagaaagacacagtaaagaagttaaaggaaattgcattt
cccaaagcagaagagctgaaggaagagctattaaaacgatataccaaagaatatatagaa
tataatgaagaaaagaagagagaagcagaagaactcgcccggaatgtggccatccagcag
gagctggagaaggaacggcagagggtggcgcagcagaagcagcagcagttggaacaggag
cagttccatgcctttgaggagatgatccggaaccaggaactggaaaaggagcggctgaaa
atcgtgcaagagtttgggaaggtggaccctggcctaggcgggcctctggtgccggacttg
gagaagccctccccagacatattccccccagcacctgtcgcatctgcacagcctgcggac
tgtaatacagctgtaaggcctgccaagccacctgtggtagacaggtccttaaaacctgga
gcattgagcaactcagaaagtactcctacaatcgatggactgcgccatgtggtggtacct
gaaaggctctgtccacagtttctccagctagccagtgccaacacagcccgaggagtggag
acatgtggaattctctgtggaaaactgatgaagaatgaatttaccattacccatgttctc
atccccaagcaaagtgcggggtctgattattgccacactgagaatgaagaagagctcttc
ctcatacaggatcaacagggtcttatcacactgggctggatccatactcatcccacacag
actgccttcctctccagtgttgatctacacactcattgctcctaccagatgatgttgccg
gaatcaatagccattgtttgctcccccaagttccaggaaactggattctttaaattaact
gaccatggactagaagagatttcttcctgtcgccagaaaggatttcatccacacagcaag
gatccacctctcttctgtagctgcagccacgtgactgttgtggatagagcagtgaccatc
acagaccttcgatga

DBGET integrated database retrieval system