KEGG   Canis familiaris (dog): 100684506Help
Entry
100684506         CDS       T01007                                 

Gene name
USP47
Definition
(RefSeq) ubiquitin specific peptidase 47
  KO
K11857  
ubiquitin carboxyl-terminal hydrolase 47 [EC:3.4.19.12]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100684506 (USP47)
Peptidases [BR:cfa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100684506 (USP47)
Ubiquitin system [BR:cfa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100684506 (USP47)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
21
AA seq 1412 aa AA seqDB search
MNNNKKPYLLYKKWEVQQLFLHSPGSGHLFPVFDDSEESCYKYLHTIFWADVFWRCRQNI
FDEMKKKFLQIENAAEEPRVLCIIQDTTNSKTVNERITLNLPASTPLRKLFEDVANKVGY
INGTFDLVWGNGINAADMAPLDHTSDKSLLDANFEPGKKNFLHLTDKDGEQPQILLEDSS
AGDDNVHDRFIGPLPREGSVGSTSDYVSQNYSYSSILNKSETGYVGLVNQAMTCYLNSLL
QTLFMTPEFRNALYKWEFEESEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWD
SSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINELYQGKLKDYVRCLECGYEGWRIDT
YLDIPLVIRPYGSSQAFASVEEALHAFIQPEILDGPNQYFCERCKKKCDARKGLRFLHFP
YLLTLQLKRFDFDYTTMHRIKLNDRMTFPEELDMSTFIDVEDEKSPQTESCTDSGAENEG
SCHSDQMSNDFSNDDGVDEGICLESNSGTEKISKPGLEKNSLIYELFSVMVHSGSAAGGH
YYACIKSFSDEQWYSFNDQHVSRITQEDIKKTHGGSSGSRGYYSSAFASSTNAYMLIYRL
KDPARNAKFLEVDEYPEHIKNLVQRERELEEQEKRQREIERNTCKIKLFCLHPVKQVMME
NKLEVHKDKTLKEAVEMAYKMMDLEEVIPMDCCRLVKYDEFHDYLERSYEGEEDTPMGLL
LGGVKSTYMFDLLLETRKPDQVFQSYKPGEVMVKVHVVDLKAESVAAPVTVRAYLNQTVT
EFKQLISKAIHLPAETMRIVLERCYNDLRLLTVPSKTLKAEGFFRSNKVFVESSETLDYQ
MAFTDSHLWKLLDRHANTIRLFVLLPEQSPGSYSKRTACQKAGGDSGNVDDDCERVKGPV
GSLKSVEAILEESTEKLKSLSLQQQQDGDNGDSSKSTETSDFENIESPLNERDSSTSVDN
RELEQHIQTSDPENFQSEERSDSDVNNDRSTSSVDSDILSSSHSSDTLCNADNAQIPLAN
GLDSHSITSSRRTKANEGKKETWDTAEEDSGTDSEYDESGKSRGEIQYMYFKAEPYAADE
GSGEGHKWLMVHVDKRITLAAFKQHLEPFVGVLSSHFKVFRVYASNQEFESVRLNETLSS
FSDDNKITIRLGRALKKGEYRVKVYQLLVNEQEPCKFLLDAVFAKGMTVRQSKEELIPQL
REQCGLELSIDRFRLRKKTWKNPGTVFLDYHIYEEDINISSNWEVFLEVLDGVEKMKSMS
QLAVLSRRWRPSEMKLDPFQEVVLESSSVDELREKLSEISGIPLEDIEFAKGRGTFPCDI
SVLDIHQDLDWNPKVSTLNVWPLYICDDGAVIFYRDKTEELMELTDEQRNELMKKESSRL
QKTGHRVTYSPRKEKALKIYLDGAPNKDLTQD
NT seq 4239 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaacaaaaaaccctacctgctctataagaagtgggaagtgcaacaattgttt
ctccattcaccaggtagtggacatttgtttccagtttttgatgactctgaagaaagctgc
tacaagtatttgcatacaattttttgggcagatgtgttttggagatgcagacaaaatatc
tttgatgaaatgaagaagaaatttttacagatagaaaatgctgctgaagaacctagagtt
ttatgtataatacaagatactactaattcaaagacagtaaatgaacggatcactttaaat
ttaccagcttctactccactcaggaagctctttgaagatgtggccaacaaagtaggctac
ataaatggaacctttgatttagtgtggggaaatggaatcaatgctgctgatatggctcca
ttggaccataccagtgacaagtctcttcttgatgctaattttgagccaggaaagaagaac
tttctgcatttgacagataaagatggtgaacagcctcaaatactgctggaggattccagt
gctggagatgataatgtccatgaccgatttataggtccacttccaagagaaggttctgtg
ggctctaccagtgattatgtcagccaaaactactcctattcatctattttgaataaatca
gaaactggatatgtgggattagtaaaccaagcaatgacttgctatttgaatagccttttg
cagacactttttatgactccagaatttaggaatgcattgtataagtgggaatttgaagaa
tctgaagaagatccagtgacaagtatcccataccaacttcaaaggctttttgttttgtta
caaaccagcaaaaagagagctattgaaaccacagatgttacgaggagctttggatgggat
agtagtgaggcttggcagcagcatgatgtacaagaactgtgcagagtcatgtttgatgct
ttggaacagaaatggaaacaaacagaacaggctgatcttataaatgaactgtatcaagga
aagctgaaggactacgtgagatgtctggaatgtggttatgagggctggagaatcgacaca
tatcttgatattccattggtcatccggccttatgggtccagtcaagcatttgctagtgtg
gaagaagcactgcatgcatttattcagccagagatcctggatggcccaaatcagtacttt
tgtgaacgttgtaagaagaaatgtgatgcacgaaagggtcttcggtttttgcatttccct
tatctgctcaccttacagttgaaaaggtttgattttgattatacaaccatgcacaggatt
aaattgaatgatcggatgacattccctgaagagctagatatgagtacgtttattgacgtt
gaagatgagaaatcccctcagacggaaagttgcacagacagcggggcagaaaatgaaggc
agttgtcacagtgatcaaatgagcaatgatttctcgaatgatgatggtgttgatgaaggg
atctgccttgaaagtaatagtggaactgaaaagatttcaaaacctggccttgagaagaat
tccttgatctatgagctcttctccgttatggttcattcagggagtgctgctggtggccat
tattatgcttgtataaagtccttcagtgatgaacagtggtacagcttcaatgatcaacat
gtcagcaggataacacaagaggacattaagaaaacacatggtggatcttcaggaagcaga
ggatattactcaagtgcttttgcaagctccacaaatgcatatatgctgatatatagactg
aaggatccagcacgaaatgcaaaatttctagaagtagatgaatatccagaacatattaaa
aacttggtgcagagagagagagaattggaagaacaagaaaaaagacaacgagaaattgag
cgcaatacatgcaagataaagttattctgtttgcatcctgtgaaacaagtaatgatggaa
aataaattggaggttcataaggataagacattaaaagaggcagtagaaatggcttataag
atgatggatttagaagaggtcatacccatggattgctgtcgccttgttaaatatgatgag
tttcatgattatcttgaacgatcatatgaaggagaagaagatacaccaatgggacttcta
ctaggaggagtcaagtcaacatatatgtttgatctgctactggagacgagaaagcctgat
caagttttccagtcttataaacctggagaagtgatggtgaaagttcatgttgttgatctt
aaggcagaatctgtagcagctcctgtcactgttcgtgcttacttaaatcaaacagtcacg
gagttcaaacaacttatttcaaaggccatccacttacctgccgaaacaatgcggatagtg
ctggaacgctgctacaatgatctgcgtcttctcactgtgccgagtaagaccctgaaagct
gaagggttttttagaagtaacaaggtgtttgttgaaagttctgagactttggattaccag
atggcctttacagattcccatttgtggaaactcctggatcgtcatgcaaatacgatcaga
ttatttgttttgttacctgaacagtccccaggatcttattccaaaaggacagcatgccag
aaagctgggggcgattctggtaatgtggatgatgactgtgaaagagtcaaaggacctgtg
gggagcctaaagtctgtggaagctattctagaagaaagcactgaaaaactcaaaagcttg
tcactacagcagcagcaagatggagataatggggacagcagcaaaagtactgagacaagt
gactttgaaaacatagaatcacctctcaatgagagggactcttcaacatcagtggacaat
agagaacttgaacagcacattcaaacttctgatcctgaaaattttcagtctgaagaacga
tcagactcagatgtgaataatgacaggagtacaagttcagtggacagtgacattcttagc
tccagtcatagcagtgacactttgtgcaatgcagataatgctcagattcctttggctaat
ggacttgattctcatagcatcacaagtagtagaagaactaaagcaaatgaagggaaaaaa
gaaacctgggatacagcagaagaagactctggaactgatagtgaatacgatgagagtggc
aagagcaggggagaaatacagtacatgtatttcaaagcagaaccctatgctgcagacgaa
ggttctggggaaggacataaatggttgatggtgcatgttgataaaagaattactctggct
gctttcaaacaacatttagagccctttgttggagttttgtcctctcacttcaaggtcttt
cgagtgtatgccagcaatcaagagtttgagagcgtccgactgaatgagacactttcatca
ttttcagatgacaataagattacaattagactggggagagcacttaaaaaaggagaatac
agagttaaagtgtaccagcttctggtcaatgaacaagagccatgcaagtttctgctagat
gctgtgtttgctaaaggaatgactgtacggcaatcaaaagaggaattaattcctcaactc
agggagcagtgtggtttagagctcagtattgacagatttcgtctaaggaaaaaaacatgg
aagaatcctggcactgtctttttggattatcatatttatgaagaagatattaatatttcc
agcaactgggaggttttccttgaagttcttgatggggtagagaagatgaaatccatgtcc
cagctggctgttctgtcaagacggtggagaccttcagagatgaaactggatcccttccag
gaggttgtgttggaaagcagtagtgtcgatgagctgcgagagaagctttctgaaatcagt
ggaattcctttggaagatattgaatttgccaagggtagaggaacttttccctgtgatatt
tctgtccttgatattcatcaggatttggactggaatcctaaagtttctaccctgaatgtc
tggcctctttatatctgtgatgatggtgcagtcatattttatagggataaaacagaagaa
ttaatggaattaacagatgagcaaagaaatgaactgatgaaaaaagaaagcagtcgactc
cagaagacaggacatcgtgtaacatactcacctcggaaagagaaagcactaaaaatatat
ctggatggagcaccaaataaagatctgactcaagactga

DBGET integrated database retrieval system