KEGG   Canis familiaris (dog): 100686499Help
Entry
100686499         CDS       T01007                                 

Gene name
GLS2
Definition
glutaminase 2 (liver, mitochondrial)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
cfa  Canis familiaris (dog)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100686499 (GLS2)
   00330 Arginine and proline metabolism
    100686499 (GLS2)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    100686499 (GLS2)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    100686499 (GLS2)
  Nervous system
   04724 Glutamatergic synapse
    100686499 (GLS2)
   04727 GABAergic synapse
    100686499 (GLS2)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100686499 (GLS2)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     100686499 (GLS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 602 aa AA seqDB search
MRSLRALQEALSGAGAQCRLGGWGRPSRSPLLGGGVRHHLSEAAALGRETPHSHQPQRQD
HDSSESGMLSRLGDLLFYTIAEGQERIPIHKFTTALKATGLQTSDPRLRDCMSQMRRMVR
ESSSGGLLDRDLFQKCVSSNIVLLTQAFRKKFVIPDFEEFTSHVDRIFEDAKELTGGKVA
AYIPQLAKSNPDLWGVSLCTVDGQRHSVGHTKIPFCLQSCVKPLTYAISISTLGTEYVHK
FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDFVLQYLNKMAG
NEYIGFSNATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQLCSVEVTCESG
SVMAATLANGGICPITGESVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSAVSGA
ILLVVPNVMGMMCLSPPLDKLGNSHRGISFCQKLVSLFNFHNYDNLRHCARKLDPRREGG
EVRNKTVVNLLFAAYSGDVSALRRFALSAMDMEQKDYDSRTALHVAAAEGHIEVVKFLIE
ACKVNPFVKDRWGNVPLDDAVQFNHLEVVKLLQDYQDSYTPSETQAEAAAEALSKENLES
MV
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccctcagggctctgcaggaggcgctgagcggggccggcgctcagtgccggctg
ggaggctggggccgcccgagccggagccctctccttggcgggggcgtccggcaccacctc
agtgaggccgcggcgctgggcagggagacgccgcacagccaccagccgcagcgccaggat
catgattcatcagagagtggcatgctatcccgcctgggtgatctcctcttctacactatt
gctgaaggacaggaacgaatccccatccacaagttcactactgcactgaaggccactgga
ctgcagacatcagatccccggctccgggactgcatgagccagatgcgccgcatggttcga
gagtccagcagtggtggcctcttggaccgagatctcttccaaaagtgtgtgagcagcaac
attgtgctcctgacccaggcattccgaaagaagtttgtcattcctgattttgaggagttc
acgagccatgtggatcgcatctttgaggatgccaaagagctcactggaggcaaagtggcg
gcttatatccctcagctggccaagtccaatccagacctgtggggcgtctccttgtgcact
gtggatggtcaacggcactccgtgggccacacaaagattcccttctgcctgcagtcctgt
gtgaagcccctcacctatgctatctccataagcaccctagggactgagtacgtgcacaag
tttgtgggcaaggagcccagtggcctacgctacaacaagctgtccctcaatgaggaagga
atcccccataaccccatggtcaatgctggtgccattgtcgtgagctccctgatcaagatg
gactgtaacaaagcagagaagtttgattttgtgttacagtatctgaacaaaatggctggg
aacgaatacataggtttcagcaatgccacattccagtcagagaaggaaacaggggatcgg
aattatgccatcggctattatctaaaggaaaagaagtgctttcctaagggggtggacatg
atggctgctcttgatctctatttccagctgtgctctgtggaggtgacctgtgagtcgggc
agcgtcatggcagccaccctggccaacggcgggatctgccccatcacgggggagagcgtc
ctgagtgctgaagcagtgcgcaacaccctcagcctcatgcactcctgtggcatgtatgac
ttctcgggccagtttgccttccacgtgggcctgccggccaagtcagctgtgtcaggagcc
atcctcctagtggtacccaatgtcatgggaatgatgtgtctgtcacctccactggacaag
ctagggaacagccataggggcatcagcttctgccagaagctggtatctcttttcaatttc
cacaactacgacaacctgaggcactgtgctcggaagttagacccacggcgtgaaggggga
gaagttcggaacaagactgtggtgaacctgttatttgctgcctatagtggagatgtctca
gctcttcgaaggtttgccttgtcagccatggacatggaacagaaagactatgattcccgc
acagccctgcatgttgctgcggctgaaggacacattgaagttgttaaattcctgattgaa
gcttgcaaagtgaatccttttgtcaaggacaggtggggcaacgttcccttggatgatgct
gtgcagttcaaccacctggaggttgtgaaactgctgcaggattaccaggactcctacaca
ccatctgagactcaggccgaggcagcggctgaggccctgtccaaagaaaacttagagagc
atggtgtga

DBGET integrated database retrieval system