KEGG   Canis familiaris (dog): 100686687Help
Entry
100686687         CDS       T01007                                 

Gene name
USP27X
Definition
(RefSeq) ubiquitin specific peptidase 27, X-linked
  KO
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100686687 (USP27X)
Peptidases [BR:cfa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100686687 (USP27X)
Transcription machinery [BR:cfa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100686687 (USP27X)
Ubiquitin system [BR:cfa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100686687 (USP27X)
Chromosome [BR:cfa03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    SAGA complex
     100686687 (USP27X)
    SLIK complex
     100686687 (USP27X)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
X
AA seq 791 aa AA seqDB search
IKRKRGLAAEAASARGLLREDSRGASPASAAASFSESPFWVQLSQAPRSLRPGGGHPRSA
WPPRRHAQWPPEPCEQGEEPPPVEAEEVEEAETAETAEKAERKVEAEAKVEGKVEAAGKV
EAAGKVEAAGKVDAAGKVETAEGPGRRVELKLEPEPEPVPEAEQEPKGEPKQELEDENPA
RSGGGGSSDEVPPPTLPSDPPRPPDPSPRRSRAPRRRPRPRPQTRLRTPPQPRPRPPPRP
RPRRGPGVGCLDVDFAVGPPGCSHVNSFKVGENWRQELRVIYQCFVWCGTPETRKSKAKS
CICHVCGTHLNRLHSCLSCVFFGCFTEKHIHEHAETKQHNLAVDLYYGGIYCFMCKDYVY
DKDIEQIAKEEQGEALKLQASTSTEVSHQQCSVMGLGEKYPTWEMTKPELELLGYNPRRR
RITSSFTIGLRGLINLGNTCFMNCIVQALTHTPILRDFFLSDRHRCEMPSPELCLVCEMS
SLFRELYSGNPSPHVPYKLLHLVWIHARHLAGYRQQDAHEFLIAALDVLHRHCKGDDAGK
AANNPNHCNCIIDQIFTGGLQSDVTCQACHGVSTTIDPCWDISLDLPGSCTSFWPMSPGR
ESSVNGESHIPGITTLTDCLRRFTRPEHLGSSAKIKCGSCQSYQESTKQLTMNKLPVVAC
FHFKRFEHSAKQRRKITTYISFPLELDMTPFMASSKESRMNGQLQLPTNSGNDENKYSLF
AVVNHQGTLESGHYTSFIRHHKDQWFKCDDAVITKASIKDVLDSEGYLLFYHKQVLEHES
EKVKEMNTQAY
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
attaaaaggaaacggggcctggctgccgaagcggcctccgctagggggctactgcgggag
gattcccggggggcgtcgcctgcttccgccgccgcctccttcagtgaaagtcccttttgg
gtccagctgtcacaggcaccgcgctccctcaggccgggcgggggacaccccaggtctgcg
tggcccccgcgccgccacgcccagtggccgccagagccctgcgagcagggggaggagccg
ccgccagtggaggcggaggaggtagaggaggcggagacggcggagacggcggagaaggcg
gagaggaaggtggaggcggaggcgaaggtggaggggaaggtggaggcggcggggaaggtg
gaggcggcggggaaggtggaggcggcggggaaggtggacgccgccgggaaggtggagaca
gcagagggtccgggccgccgggttgagctcaagctggagcccgaacccgagccggtaccg
gaggcggagcaggagccgaagggggagccgaagcaggagctggaggatgagaacccggcg
cggagcggcggtggcggcagcagcgacgaggttcctccccccacccttccctccgacccc
ccgcggccccccgatccctctcctcggcgcagtcgtgccccccgccgccgaccccggcca
cggccacagacccgactccgtaccccgccgcagcctaggccacggcccccgccccggccc
cggccccggcgcggccctggggtcggatgcctggatgtggatttcgctgtgggtccacca
ggctgttcccacgtgaacagctttaaggtgggagagaactggaggcaggaactgcgggtg
atctaccagtgcttcgtgtggtgtggaaccccagagaccaggaaaagcaaggcaaagtcg
tgcatctgccatgtgtgtggcacccatttgaacagacttcactcttgcctttcctgtgtc
ttctttggctgcttcaccgagaaacacattcacgagcacgccgagacaaaacaacacaac
ttagccgtagacctttattacggaggtatatactgctttatgtgtaaggattatgtgtat
gacaaagacattgagcaaattgccaaagaagagcaaggagaagctttgaaattacaagcc
tccacctcaaccgaggtttctcaccagcagtgttcagtgatgggactcggtgagaaatat
ccaacctgggagatgaccaaacccgagttagaactgctggggtacaatccgaggagaaga
aggatcacctccagctttaccatcggtctgagaggactgatcaatcttggcaacacgtgc
tttatgaactgcatcgtccaggcccttacccatactcccatactgagagatttcttcctc
tctgacaggcacaggtgtgagatgccgagtcctgagctgtgtctggtctgcgagatgtct
tcactctttcgggagttgtactctggaaacccgtctcctcacgttccttataagttgctg
cacctggtatggatacatgcacgccacttagcagggtacaggcagcaggatgcccacgaa
ttcctcattgcagccttagacgtcctgcacaggcactgcaaaggcgatgatgctgggaaa
gctgccaacaatcccaaccactgtaactgcatcatagaccaaatcttcacaggtggcctg
cagtcggatgtcacctgtcaagcctgccatggtgtctccaccaccatagacccatgctgg
gacatcagtttggacttgcctggctcgtgcacctccttctggcccatgagcccagggagg
gagagcagtgtgaatggggagagccacatcccaggaatcaccaccctcacagactgcttg
cgaaggtttacaaggccagagcacttgggaagcagtgccaaaatcaagtgcggtagttgc
caaagctaccaggagtctaccaagcaactcacgatgaataaattacctgttgttgcctgt
tttcatttcaaacggttcgaacactctgccaaacagaggcgcaagatcactacatatata
tcctttcctctggagctggatatgaccccatttatggcctcaagtaaagagagtaggatg
aatggacagttgcagctgccaaccaatagtggaaacgacgagaataagtattccttgttt
gctgtggttaatcaccaaggaaccttggagagcggccattacaccagcttcatccggcac
cacaaggaccagtggttcaagtgtgatgatgccgtcatcaccaaggccagtattaaggac
gtgctggacagtgaagggtatttactgttctatcacaaacaggtcctggagcacgagtca
gaaaaagtgaaagaaatgaatacacaagcctactga

DBGET integrated database retrieval system