KEGG   Canis familiaris (dog): 100686687Help
Entry
100686687         CDS       T01007                                 

Definition
ubiquitin carboxyl-terminal hydrolase 22-A-like
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
cfa  Canis familiaris (dog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
X
AA seq 791 aa AA seqDB search
IKRKRGLAAEAASARGLLREDSRGASPASAAASFSESPFWVQLSQAPRSLRPGGGHPRSA
WPPRRHAQWPPEPCEQGEEPPPVEAEEVEEAETAETAEKAERKVEAEAKVEGKVEAAGKV
EAAGKVEAAGKVDAAGKVETAEGPGRRVELKLEPEPEPVPEAEQEPKGEPKQELEDENPA
RSGGGGSSDEVPPPTLPSDPPRPPDPSPRRSRAPRRRPRPRPQTRLRTPPQPRPRPPPRP
RPRRGPGVGCLDVDFAVGPPGCSHVNSFKVGENWRQELRVIYQCFVWCGTPETRKSKAKS
CICHVCGTHLNRLHSCLSCVFFGCFTEKHIHEHAETKQHNLAVDLYYGGIYCFMCKDYVY
DKDIEQIAKEEQGEALKLQASTSTEVSHQQCSVMGLGEKYPTWEMTKPELELLGYNPRRR
RITSSFTIGLRGLINLGNTCFMNCIVQALTHTPILRDFFLSDRHRCEMPSPELCLVCEMS
SLFRELYSGNPSPHVPYKLLHLVWIHARHLAGYRQQDAHEFLIAALDVLHRHCKGDDAGK
AANNPNHCNCIIDQIFTGGLQSDVTCQACHGVSTTIDPCWDISLDLPGSCTSFWPMSPGR
ESSVNGESHIPGITTLTDCLRRFTRPEHLGSSAKIKCGSCQSYQESTKQLTMNKLPVVAC
FHFKRFEHSAKQRRKITTYISFPLELDMTPFMASSKESRMNGQLQLPTNSGNDENKYSLF
AVVNHQGTLESGHYTSFIRHHKDQWFKCDDAVITKASIKDVLDSEGYLLFYHKQVLEHES
EKVKEMNTQAY
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
attaaaaggaaacggggcctggctgccgaagcggcctccgctagggggctactgcgggag
gattcccggggggcgtcgcctgcttccgccgccgcctccttcagtgaaagtcccttttgg
gtccagctgtcacaggcaccgcgctccctcaggccgggcgggggacaccccaggtctgcg
tggcccccgcgccgccacgcccagtggccgccagagccctgcgagcagggggaggagccg
ccgccagtggaggcggaggaggtagaggaggcggagacggcggagacggcggagaaggcg
gagaggaaggtggaggcggaggcgaaggtggaggggaaggtggaggcggcggggaaggtg
gaggcggcggggaaggtggaggcggcggggaaggtggacgccgccgggaaggtggagaca
gcagagggtccgggccgccgggttgagctcaagctggagcccgaacccgagccggtaccg
gaggcggagcaggagccgaagggggagccgaagcaggagctggaggatgagaacccggcg
cggagcggcggtggcggcagcagcgacgaggttcctccccccacccttccctccgacccc
ccgcggccccccgatccctctcctcggcgcagtcgtgccccccgccgccgaccccggcca
cggccacagacccgactccgtaccccgccgcagcctaggccacggcccccgccccggccc
cggccccggcgcggccctggggtcggatgcctggatgtggatttcgctgtgggtccacca
ggctgttcccacgtgaacagctttaaggtgggagagaactggaggcaggaactgcgggtg
atctaccagtgcttcgtgtggtgtggaaccccagagaccaggaaaagcaaggcaaagtcg
tgcatctgccatgtgtgtggcacccatttgaacagacttcactcttgcctttcctgtgtc
ttctttggctgcttcaccgagaaacacattcacgagcacgccgagacaaaacaacacaac
ttagccgtagacctttattacggaggtatatactgctttatgtgtaaggattatgtgtat
gacaaagacattgagcaaattgccaaagaagagcaaggagaagctttgaaattacaagcc
tccacctcaaccgaggtttctcaccagcagtgttcagtgatgggactcggtgagaaatat
ccaacctgggagatgaccaaacccgagttagaactgctggggtacaatccgaggagaaga
aggatcacctccagctttaccatcggtctgagaggactgatcaatcttggcaacacgtgc
tttatgaactgcatcgtccaggcccttacccatactcccatactgagagatttcttcctc
tctgacaggcacaggtgtgagatgccgagtcctgagctgtgtctggtctgcgagatgtct
tcactctttcgggagttgtactctggaaacccgtctcctcacgttccttataagttgctg
cacctggtatggatacatgcacgccacttagcagggtacaggcagcaggatgcccacgaa
ttcctcattgcagccttagacgtcctgcacaggcactgcaaaggcgatgatgctgggaaa
gctgccaacaatcccaaccactgtaactgcatcatagaccaaatcttcacaggtggcctg
cagtcggatgtcacctgtcaagcctgccatggtgtctccaccaccatagacccatgctgg
gacatcagtttggacttgcctggctcgtgcacctccttctggcccatgagcccagggagg
gagagcagtgtgaatggggagagccacatcccaggaatcaccaccctcacagactgcttg
cgaaggtttacaaggccagagcacttgggaagcagtgccaaaatcaagtgcggtagttgc
caaagctaccaggagtctaccaagcaactcacgatgaataaattacctgttgttgcctgt
tttcatttcaaacggttcgaacactctgccaaacagaggcgcaagatcactacatatata
tcctttcctctggagctggatatgaccccatttatggcctcaagtaaagagagtaggatg
aatggacagttgcagctgccaaccaatagtggaaacgacgagaataagtattccttgttt
gctgtggttaatcaccaaggaaccttggagagcggccattacaccagcttcatccggcac
cacaaggaccagtggttcaagtgtgatgatgccgtcatcaccaaggccagtattaaggac
gtgctggacagtgaagggtatttactgttctatcacaaacaggtcctggagcacgagtca
gaaaaagtgaaagaaatgaatacacaagcctactga

DBGET integrated database retrieval system