KEGG   Canis familiaris (dog): 100686778Help
Entry
100686778         CDS       T01007                                 

Gene name
CYP1A1
Definition
cytochrome P450, family 1, subfamily A, polypeptide 1
Orthology
K07408  
cytochrome P450, family 1, subfamily A, polypeptide 1 [EC:1.14.14.1]
Organism
cfa  Canis familiaris (dog)
Pathway
Steroid hormone biosynthesis
Tryptophan metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Metabolic pathways
Ovarian steroidogenesis
Chemical carcinogenesis
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:cfa00140]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:cfa00380]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:cfa00830]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:cfa00980]
Organismal Systems; Endocrine system; Ovarian Steroidogenesis [PATH:cfa04913]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:cfa05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
30
AA seq 524 aa AA seqDB search
MMSMFRLSIPISASELLLASTVFCLVLWVVKAWQPRLPKGLKSPPGPWGWPLLGNVLTLG
KSPHLALSRLSQRYGDVLQIRIGSTPVLVLSGLDTIRQALVRQGDDFKGRPDLYSFSLVT
DGQSLTFSPDSGPVWAARRRLAQNALKSFSIASDPASSCSCYLEEHVSKEAEVLLSRLQE
QMAEVGRFDPYRYIVVSVANVICAMCFSKRYDHDDQELLSLVNLSNEFGEGVASANPLDF
FPILRYLPNPALDFFKDLNKRFYSFMQKMVKEHYKTFEKGQIRDVTDSLIEHCQDKRLDE
NANIQLSDEKIVNVVLDLFGAGFDTVTTAISWSLLYLVTNPNVQKKIQKELDTVIGRARQ
PRLSDRPQLPYMEAFILETFRHASFVPFTIPHSTTRDTSLSGFYIPKGRCVFVNQWQINH
DQKLWGNPSEFQPERFLTLDGTINKALSEKVILFGLGKRKCIGETIARLEVFLFLAILLQ
QVEFSVPEGTKVDMTPIYGLTMKHARCEHFQVRVRTEGAESSAA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccatgttcagactctccatccccatctcggcctcagagcttctcctggcctcc
accgtcttctgcttggtactctgggtggtcaaggcctggcagcctcggcttcccaaaggc
ctgaagagtccaccggggccctggggctggcccctgctcgggaacgtgctgaccttgggc
aagagcccccacctggcgctgtccaggctgagccagcgttatggggacgtgctgcagatc
cgcatcggctccacccccgtgctggtgctcagtggcctggacaccatccggcaggccctg
gtgcgccagggggatgatttcaagggccggcccgacctctacagcttctctctggttacc
gacggccaaagcctgaccttcagcccagactccggaccagtgtgggctgcgcgcaggcgc
ctggcccagaacgcgctgaagagtttctccattgcctccgacccggcttcctcgtgctct
tgctacctggaagagcatgtgagcaaggaggccgaggtccttctcagcaggctgcaggag
cagatggcagaggttgggcgctttgatccctatagatacatagtggtgtcggtggccaac
gtcatctgtgccatgtgctttagcaagcgctatgaccatgacgaccaggagctgcttagc
ttagtcaacctgagtaatgagtttggagagggggttgcctctgcgaaccccttggacttc
tttcccatccttcgatacctacccaaccctgccctggatttcttcaaggacctgaataag
agattctacagcttcatgcaaaagatggtcaaggaacactataaaacgtttgagaagggc
caaattcgggatgtcacagacagcctgatcgagcactgtcaggataagaggctggatgag
aatgccaatatccagctgtctgatgagaagattgttaatgttgtcttggacctctttgga
gctggatttgacacagtcacaactgccatctcctggagcctcctgtacttggtgacaaac
cccaatgtacagaaaaagatccagaaggagctggacacagtgattggcagggcacggcaa
ccccggctctctgacaggccccagctgccctacatggaggcattcatcctggagaccttc
cgacatgcttccttcgtccccttcaccatccctcatagcaccacaagagacacgagtctg
agtggcttttacatccccaagggacgttgcgtctttgtgaaccagtggcagatcaaccat
gaccagaagctatggggtaacccgtctgagttccaaccagaacgattcctcactctcgat
ggcaccatcaacaaggcactgagtgagaaggtgattctctttggtttgggcaagcggaag
tgcatcggtgagaccatcgctcgcttggaggtctttctctttctggccatcctgctgcag
caggtggaatttagtgtgccagagggcacaaaggtagatatgacccccatttatgggctg
accatgaagcacgcccgctgtgaacacttccaagtgagggtgcgcactgagggggctgag
agctctgcagcctag

DBGET integrated database retrieval system