KEGG   Canis familiaris (dog): 100688666Help
Entry
100688666         CDS       T01007                                 

Gene name
MLL4
Definition
myeloid/lymphoid or mixed-lineage leukemia 4
Orthology
K14959  
histone-lysine N-methyltransferase MLL4 [EC:2.1.1.43]
Organism
cfa  Canis familiaris (dog)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100688666 (MLL4)
Enzymes [BR:cfa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100688666 (MLL4)
Transcription factors [BR:cfa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    100688666 (MLL4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 2711 aa AA seqDB search
GRFPGRPRGSAGGGGRGGRGSGAERVRVALRRGGGAAGPGGAEPGEDTALLRLLGLRRGL
RRLRRLWAGPRIQRGRGRGRGRGWGPSRGCVPEEESSDEESDDEEFQGFHSDEDVAPSSL
RSALRSQRGRAPRGRGRKHKTTPIPPPRLADVAPTPPKTPARKRGEEGTERMVQALTELL
RRAQAPPAPRSRACEPSTPRRSRGRPPGRPAGPCRKKQQAVVVAEAAVTIPKPEPPPPVV
PVRHRTGSWKCKEGPGPGPGTPKRGGQSGRGGRGSRGRGRGGLPLVIKFVSKAKKMKMGQ
LSLGLESGQGQDQHEESWQDAPQGRVGSGQGEGPCWRKEQKLEEEAEKETKEKDKEEREE
KVETAGPEEEMVLAEEKEEAKPPNPPSTPPAPPPPPPSPPPPPPPPLPPPSTSPSSPLCP
PPPPVSPLPPPSPQPPPAPEEQQEESPPPVVPAACSRKRGRPPLTPSQRAEREAARAMPE
GTSPPTPAPSTTTGGPLEDSPTVAPKSTTFLKNIRQFIMPVVSARSSRVIKTPRRFMDED
PPKPLKVEVSPTLRPPVATSPLVPPEPAPAPSPPRAPTPPSTPVPLPEKRRSILREPTFR
WTSLTRELPPPPPAPPPAPPPLPVPVPPSRRPLLLRAPQFTPSEAHLKIYESVLTTPLGA
PEAPEPEPPPADDSPAEPEPRAVGRTNHLSLPRFAPVVATPVKAEVPLPGAPALSNGQQS
QAQLQQPLQALPTQLPPQALPPQQPQLQPHLQLQPQPLPQQPSPLEKARIAALGSLPLSG
VEEKMFSLLKRAKVQLFKIDQQQQQQKVASLMPPSPGGQMEEVVGTVKQISDRGSVRSED
ESMETKRERPSGPESPVQGPRIKHVCRHAAVALGQARAMVPEDVPRLSALPLRDRQDLAT
EDTSSASETESVPSRSRRGKVESAGPGGDSEPAGSGGTLAHTPRRSLPSHHGKKMRMARC
GHCRGCLRVQDCGSCVNCLDKPKFGGPNTKKQCCVYRKCDKIEARKMERLAKKGRTIVKT
LLPWDSDESPEASPGPPGPRRGAGAGGPREEVVAPPGPEEQDSLLLQRKSARRCVKQRPS
YDIFEDSDDSEPGGPPAPRRRTPRENELPLPEPEEQSRPRKPTLQPVLQLKARRRLDKDA
LAPGPFASFPNGWTGKQKSPDGVHRVRVDFKEDCDLENVWLMGGLSVLTSVPGGPPMVCL
LCASKGLHELVFCQVCCDPFHPFCLEEAERPLPQHHDTWCCRRCKFCHVCGRKGRGSKHL
LECERCRHAYHPACLGPSYPTRATRKRRHWICSACVRCKSCGATPGKNWDVEWSGDYSLC
PRCTQLYEKGNFCPICTRCYEDNDYESKMMQCAQCDHWVHAKCEGLSDEDYEILSGLPDS
VLYTCGPCAGATHPRWREALSGALQGGLRQVLQGLLSSKVAGPLLLCTQCGQAGKQLHSG
PCDLQAVSRRFEEGHYKSVHSFMEDMVGILMRHSEEGETPERRAGGQMKGLLLKLLESAF
GWFDAHDPKYWRRSTRLPNGVLPNAVLPPSLDHVYAQWRQQEPETLESGQPPGDPSAAFQ
GKDPAAFSHLEDPRQCALCLKYGDADSKEAGRLLYIGQNEWTHVNCAIWSAEVFEENDGS
LKNVHAAVARGRQMRCELCLKPGATVGCCLSSCLSNFHFMCARASYCIFQDDKKVFCQKH
TDLLDGKEIVTPDGFDVLRRVYVDFEGINFKRKFLTGLEPDAINVLIGSIRIDSLGTLSD
LSDCEGRLFPIGYQCSRLYWSTVDARRRCWYRCRILEYRPWGPREEPVHLEAAEENQTIV
HSPAPSSEPPDHADPPPDTDALIPGAPEHHSPVQNPDPPLRPDPSSAPPPAPRSFSGARI
KVPNYSPSRRPLGGVSFGPLPSPGSPSSLTHHIPTVGDLDFPAPPRRSRRPSPLAPRLPA
SRRASPPLRSSPQLRVPPPTSVVRALTPTSGEPAPPGPTPSPPPPPEDLGPDFEDMEVVS
GLSAADLDFAASLLGTEPFQEEIVAAGAVGSSHGGPGDSSEEEASPTPRYVHFPVTVVSG
PALAPGALPGAPRIEQLDGVDDGTDSEAEAVQQPRGQETPPSGPGVGRAGVLGAAGDRTR
PPEDLPSEIVDFVLKNLGGPGEGGAGPREEPLPPAPPLANGSQPPQGLPPSPADPTRTFA
WLPGAPGVRVLSLGPAPEPPKPATSKIILVNKLGQVFVKMAGEGEPVSPPVKQPPLPPPI
PPTAPASWTLPPGPLLGVLPVVGVVRPTPPPPPPPLTLVLSSGPPSPPHQAIRVKRVSTF
SGRSPPAPPPNKTPRLEEDGESLEDAPQGPGLSGSGFSRVRMKTPTVRGVLDLDEPGDPT
GEESPRPLQDRSPLLPLPEGGPPRAPDGPSDLLLESQWHHYSGEASSSEEEPPSPEDKEN
QAPKRAGPHLRFEISSEDGFSVEAESLEGAWRTLIEKVQEARGHARLRHLSFSGMSGARL
LGIHHDAVIFLAEQLPGAQRCQHYKFRYHQQGEGQEEPPLNPHGAARAEVYLRKCTFDMF
NFLASQHRVLPEGATCDEEEDEVQLRSTRRATSLELPMAMRFRHLKKTSKEAVGVYRSAI
HGRGLFCKRNIDAGEMVIEYSGIVIRSVLTDKREKFYDGKGIGCYMFRMDDFDVVDATMH
GNAARFINHSCEPNCFSRVIHVEGQKHIVIFALRRILRGEELTYDYKFPIEDASNKLPCN
CGAKRCRRFLN
NT seq 8136 nt NT seq  +upstreamnt  +downstreamnt
ggccgcttcccgggccggccgcggggctccgccgggggcgggggccgcggcggacggggc
agcggggccgagagagtgcgggtagctctgcggcgcggcggcggcgcggcggggccgggc
ggagccgagcccggggaggacacggccctgctccgtttgctggggctccgccggggcctg
cgccggctccgccgcctgtgggccggcccgcgcattcagcggggccggggccggggccgg
ggccggggctggggcccgagccggggctgcgtgcccgaggaagagagcagtgacgaggaa
tccgacgatgaggagtttcagggttttcattcagatgaagatgtggcccccagttccctg
cgctctgcgctccgatcccagcgaggtcgagccccccgaggtcggggccgcaagcataag
acgacccccattccgcctcctcgcctagcagatgtcgctcctacccccccaaagactcct
gcccggaaacggggtgaggagggcacagaacggatggtgcaggcactgactgaacttctc
cggcgggcccaggcacccccagccccgcggagccgggcatgtgagccctccactccacgt
cggtctcggggacggcccccaggacggccagcaggcccctgcaggaagaagcaacaagca
gtagtggtggcagaagcagctgtgacaatccctaaacctgagcccccacctcctgtggtt
cctgtaagacaccgaactggcagctggaagtgcaaagaggggcctggcccaggacctggg
acccccaagcgtggaggacagtctgggcgaggaggccgtggaagtagaggccgaggccga
ggcgggctccctctcgtgattaagtttgtttcaaaggccaaaaaaatgaagatgggacag
ttgtccttgggacttgaatcaggtcagggtcaagatcaacatgaggaaagctggcaggat
gccccccaaggaagagttggatctggacagggagagggcccctgctggaggaaggagcaa
aagctggaggaggaggcagagaaagagacaaaagaaaaagacaaggaagagagagaggag
aaggtagagacggctggacctgaagaagagatggtgctcgcagaggaaaaggaagaggca
aagccgccaaacccaccctcgactcctccagctcctcctccccctcccccgtctccaccc
cctccaccccctccacccctcccacccccctcaacttctccttcatccccgctttgtcct
ccaccgcccccagtgtcccctctgcccccgccatcgccccaaccacctcctgccccagag
gagcagcaggaagagtcccctcctccggtggtcccagccgcgtgctccaggaagaggggt
cggcctcccttgacacccagccagcgggcagagcgagaagctgctcgggccatgccagag
ggtacctctcctcccactccagcccctagcactaccacaggaggccctctggaagacagc
cccactgtggcccccaaaagtaccaccttcctgaagaatatccggcagtttattatgcct
gtggtgagtgcccgctcctcccgagtcatcaagacaccccggaggtttatggatgaagac
ccccccaaacccctaaaggtagaagtctcacctactctgcggcctcctgttgccacctcc
ccactcgtcccccctgaaccagcaccagctccctcaccaccacgtgccccaactcctcca
tctaccccagtcccactccctgagaaaagacggtccattctaagggaacccacgtttcgc
tggacctcgctgacccgggaactgccccctcctccccctgcccccccgccggccccaccc
ccacttcctgtccctgtccctccatcccggaggcccctgctccttcgggcacctcagttt
accccgagcgaagcccacctgaagatctatgaatcggtgcttactactcctcttggggcc
cctgaagcccctgagccagagcctcctcccgccgatgactctccagctgagcctgagcca
cgggcagtgggtcgcaccaaccacctcagcctgcctcgatttgcccctgtggtcgccact
cccgttaaggccgaggtgccccttcctggggctccagctctgagcaatgggcagcagtct
caggctcagctacagcagcccctgcaggccttgccaacccaactgccgcctcaggcgtta
ccaccgcagcagccacagttacagccacacttacaactgcagccgcagccactaccacag
cagccgtcaccactggaaaaggcccgtatcgcagccttgggttccttaccactgtccggc
gtggaggagaaaatgtttagcctcctcaagagagccaaggtgcagctgttcaagatcgat
cagcagcagcagcagcagaaggtggcgtctttgatgccgccgagccctggagggcagatg
gaggaagtcgtggggactgtcaagcagatctcagatagaggttctgtgaggtctgaagat
gaatcgatggaaactaagagagagagaccgtcgggccccgagtcccctgtgcaaggcccc
cgtatcaaacacgtctgtcgtcatgctgctgtggccctaggtcaggcccgggccatggtg
cctgaagacgtcccccgcctcagtgctctccctctacgggatcggcaggacctcgccacg
gaggatacgtcatcagcgtctgagactgagagtgtcccatcacggtctcggcggggaaag
gtggagtcagcagggcctgggggagactcagagcctgcagggtctggagggacccttgcc
catacaccccggcgctcgctgccctcccatcatggcaagaagatgcggatggcacggtgt
ggacactgtcggggctgcctgcgtgtgcaggactgtgggtcctgtgtcaactgcctggac
aagcccaagtttgggggccccaacaccaagaagcagtgctgtgtataccggaagtgcgac
aagatagaggctcggaagatggaacggctggctaaaaaaggccggacgatagtgaagacg
ctgttgccctgggattccgatgaatctcctgaggcctcccctggtcctccaggcccacgc
cggggggcgggagctggggggccccgggaggaggtggtggcccccccagggcccgaggag
caggactccctcctactgcagcgcaagtcagcccggcgctgcgtcaaacagcgaccctcc
tatgatatcttcgaggactcggatgattcagagcctgggggtccccctgctcctcggcgt
cggaccccccgagagaatgagctgccattgccagaacctgaggagcagagccggccccgc
aaacccaccctgcagcctgtgttgcagctcaaggcccgaaggcgcctggacaaggatgct
ctggctcctggcccctttgcttcttttcccaacggctggactggaaaacagaagtcccct
gatggggtgcaccgggtccgtgtggattttaaggaggattgtgacctggagaacgtgtgg
ttgatgggcggcctcagcgtgctcacgtctgtgccgggagggccaccgatggtgtgcttg
ctgtgtgccagcaaaggcctgcatgagctcgtgttctgccaagtgtgctgcgaccctttc
cacccgttctgcctggaggaggctgagcggcccctgccccaacatcacgacacctggtgc
tgccgtcgctgcaagttctgccacgtgtgtgggcgcaaaggccggggatccaagcacctc
ctggagtgtgagcgctgccgccatgcgtatcacccagcctgcctcgggcccagctacccg
acccgggccacacgcaagcgccgtcactggatctgctcagcctgtgtgcgctgtaagagc
tgtggggcgactccaggcaagaactgggacgtcgagtggtccggagattacagcctctgc
cccaggtgcacccagctctatgagaaaggaaacttctgcccaatctgcacacgctgctat
gaagacaacgactatgaaagcaagatgatgcagtgcgcgcagtgtgaccactgggtgcat
gccaagtgcgaggggctttcagatgaagactatgagatcctttctgggctgccagactca
gtgctgtatacctgcggaccgtgtgcaggggccacgcacccccgctggcgagaggccctg
agtggagccctgcaggggggcctgcgccaggtgctccagggcctgctgagctccaaggtg
gcaggcccactgctgctgtgcactcagtgtgggcaggctggaaagcagctgcactcaggg
ccctgcgatctgcaagccgtgagtcggcgcttcgaggaaggccactacaagtctgtgcac
agctttatggaggacatggtgggtatcttgatgaggcactcagaagaaggagaaacccca
gagcgccgggctggaggccagatgaaggggctcctactgaagctgctagagtctgcgttc
ggctggttcgacgcccacgaccccaagtactggcgacggagtacccggctgccaaacgga
gttcttcccaatgccgttttgcccccatccttggaccatgtctatgctcagtggaggcag
caggaaccagagaccctagaatcagggcagcctccaggagatccctcagcagcttttcag
ggcaaggatccagctgctttctcacacctggaggacccccgtcagtgtgcactctgcctc
aaatatggggatgcagactctaaggaggcaggacggctcctatacattgggcagaatgag
tggacacatgtcaactgtgccatttggtcagctgaagtatttgaggaaaatgatggctcc
ctcaaaaatgtgcatgctgctgtggctcgagggaggcagatgcgctgtgaactctgcctg
aagcctggagccacagtgggctgctgcctttcctcctgcctcagcaacttccacttcatg
tgtgcccgggccagctattgcatcttccaggacgacaagaaagttttctgccagaaacac
acagacctgctggatggcaaggagattgtgaccccggacgggtttgatgtactccgccga
gtctatgtggactttgagggtatcaactttaagcgaaagttcttgacggggctcgaacct
gatgccatcaatgtgctcattggctccatccgaattgactcgttgggtaccctgtctgat
ctctcggactgcgagggacggctcttccccattggctaccagtgctcccgtctgtactgg
agcacagtggatgctcggcggcgctgctggtatcggtgtcgcattctggagtatcggcca
tggggtccgagggaagagccagtccacctagaggcagcagaggagaatcagaccattgtg
cacagccctgccccttcctcagagcccccagatcatgcggaccccccaccagatacagat
gccctcatccctggagctcctgagcaccactcacccgttcagaacccagacccgccactt
cggccggatccaagcagtgcccctcctccagccccccgctccttctcgggggctcgaatc
aaagtgcccaactactcaccatcccggaggcccttggggggtgtctcctttggacccctg
ccctcccctggaagtccatcttctctgacccaccacatccccacagtgggagacctggac
ttcccagctcccccaagacggtcccgtcgtcccagccccctcgccccaaggctgccagca
tcacggcgggcctctccccctctcagaagctccccacagctcagggtgccccctcctacc
tcagttgtcagagccctcacgcctacctcaggggagccggctccccctggcccaaccccg
tctcccccaccaccccctgaagacctgggcccagactttgaggacatggaggtggtgtca
ggactgagcgctgctgacctggactttgcggccagcctgctggggactgagcccttccag
gaagagattgtggctgcaggggcagtggggagcagccatgggggtccgggggacagctca
gaggaggaggccagtccgacccctcgctatgtccacttccctgtgacggtggtgtcgggc
ccagctctggcccctggtgccctccctggagccccccgcatcgaacagctggatggagtg
gatgatggcacagacagtgaggcagaggcagtccagcagcctcggggccaggagactcct
ccttcagggccaggagtgggccgggctggggtccttggggctgcaggggacagaacccga
cctcctgaggacttgccatcagaaattgtggattttgtgctgaagaacctaggagggccc
ggggagggaggtgctgggccgagagaggagccgctccctccagcacctcccctggccaat
ggcagccagcctccccagggcctgcctcctagcccagctgacccaactcggacgtttgcc
tggctccctggggccccaggggtccgggtattgagcctgggccctgcccccgagcccccc
aaacctgccacatccaaaatcatccttgtcaacaagctggggcaagtgtttgtgaagatg
gctggggagggtgaacccgtctcacccccagtgaagcagccacctctgccccctcccatc
ccccccacagcccctgcttcctggactctgcccccgggaccgctgctgggtgtgttgcca
gtggtaggggtggtccgccccaccccgccaccaccccctcctccactgacactggtgttg
agcagtgggccccccagcccgccccatcaggccatccgtgtcaagagggtgtccaccttc
tctggccgttccccaccagcgcctcccccaaacaagaccccccggctggaagaagatgga
gagtccttggaggatgctccccagggtccagggcttagtggcagcgggtttagccgagtg
aggatgaaaacgcccacagtgcgtggagttcttgacttggatgagcctggggaccccact
ggggaggaaagcccgaggccccttcaggaccggtcccctctgctgccactcccagaaggt
ggtcctccccgggcccctgatggtccctctgacctgctgcttgagtcccagtggcaccat
tactcaggtgaggcttcaagctctgaggaagagcctccatccccagaggacaaagagaac
caggccccgaaacgggctggcccgcatctgcgctttgagatcagcagtgaggatgggttc
agcgtggaggcagagagcttggagggggcatggagaactctgatcgagaaggtgcaagag
gcccgagggcatgcccggctccggcatctctccttcagtgggatgagtggggcaaggctc
ctgggcatccaccacgacgccgtcatcttcctggcagagcagctgcccggggcccagcgc
tgccagcactataaattccgctaccaccagcagggagagggccaggaggaaccccctctg
aacccccacggggcagcccgtgccgaggtctatctccggaagtgcaccttcgacatgttc
aacttcctggcctcccagcatcgggtgctccctgagggagccacctgtgacgaggaagag
gatgaggtgcagctcaggtcaaccagacgtgccaccagcctggagctgcccatggccatg
cgctttcgccacctcaagaagacatccaaagaggctgtgggtgtctacagatctgccatc
cacgggcggggcctgttctgtaagcgaaacatcgatgctggcgagatggtcattgagtat
tctggtattgtcattcgctctgtgctgactgacaagcgggagaagttctacgatgggaag
ggtattgggtgctacatgttccgtatggatgactttgacgtggtggatgccacgatgcat
ggcaacgctgcccgcttcatcaaccactcgtgtgagcccaactgcttctctcgggtcatc
cacgtggagggccagaagcacattgtcatctttgccctgcgccgcatcctgcgtggtgag
gagctcacctatgactacaaattccccattgaggatgccagcaacaagctgccctgcaac
tgtggcgccaagcgctgccgtcggttccttaactga

DBGET integrated database retrieval system