KEGG   Canis familiaris (dog): 100688993Help
Entry
100688993         CDS       T01007                                 

Gene name
TESK1
Definition
testis-specific kinase 1
Orthology
K08841  
testis-specific kinase 1 [EC:2.7.12.1]
Organism
cfa  Canis familiaris (dog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 586 aa AA seqDB search
MAGERPPLRGPGPGPGEAPGEGPPGPGGTGGGPGRGRPSSYRAIRSAVSSLARVDDKHCA
EKIGAGFFSEESTDGNLDTHSSSPSMPQYMNGGTLEQLLSSPEPLSWPVRLRLALDIARG
LRYLHAKGVFHRDLTSKNCLIRREDRGFTAVVGDFGLAEKIPVYREGARKEPLAVVGSPY
WMAPEVLRGELYDEKADVFAFGIVLCELIARVPADPDYLPRTEDFGLDVPAFRTLVGDDC
PLPFLLLAIHCCSMEPSTRAPFTEITQHLEWILEQLPEPAPVPRAPLTHNQRSVSRGGPS
ATLPRPDPRLSRSRSDLFLPPSPESPPNWGDNLTRVNPFSLREDLRGGKIKLLDTPSKPV
APLPLVPPSPLPSMQLPSVTAPETLVQPGTPARRCRSLPSSPELPRRMETALPGPGPPTV
GPSAEERMECEGSSPEPEPPGPAPQLPLAVATDNFISTCSSASQPWSPRPGPALNNNPPA
VVVSSPQGWAGEPWNRAQHSLPRAAALERTEPSPPPSAPRESDEGLPCPGCCLGPFSFGF
LSMCPRPTPAVARYRNLNCEAGSLLCHRGHHAKPPTPGLQLPGARS
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggccggggaacggcccccactgcggggccctgggccagggcccggagaggcgccgggg
gaggggcccccggggccggggggcacgggtggaggccctggccggggccgcccctcctcc
taccgggctatacgcagcgccgtgtccagcctggcgcgcgtggacgataaacactgcgcc
gaaaagatcggggccggcttcttctctgaggaaagtacagatggaaatcttgacactcat
tcttcatctccttctatgccccagtatatgaatggggggaccctggaacagctgctcagc
tccccggaacctctatcctggcctgtcaggctccgcctggctctggacattgcccgtggc
ctgcggtacctgcatgccaaaggtgtattccaccgagacctaacatccaagaactgtctg
atacgacgggaagaccgaggcttcacggctgttgtgggtgacttcgggctggctgaaaag
attcctgtgtatagggaaggggcaagaaaggagccattggctgtggtaggttctccatac
tggatggctccagaggtgttgcggggtgagctgtatgatgagaaggccgatgtctttgca
tttgggattgtcctctgtgagctcatcgcgagagtacctgcagacccggattacctgccc
cgaactgaggactttggcctggacgtgcctgctttccggaccctggtgggggatgactgc
ccgctacccttcctgctcctggccatccattgctgcagtatggaacctagcactcgtgct
cccttcaccgagatcacccagcacctggaatggatcctggagcagctgcctgagccagcc
cctgtccccagggctcccctgacacacaatcagaggtctgtttcaagagggggtccctca
gccacacttcctaggccagacccccggctttcccgaagccggtcagacctcttcctgccc
ccatcaccagaatcaccccccaactggggggacaatctgactcgagtcaaccccttctca
ctccgggaagacctcaggggaggcaagatcaagctgttggacacacccagcaagccagtt
gcccccctgccccttgtaccgccatcaccactgccctccatgcagctgccctcagtgacc
gctccagagaccctggtccagcctgggacacctgcccgtcgctgccgctcactaccatca
tcccctgagcttccccgacgtatggagacagcactgccaggtcctggccctcccactgtg
ggcccctcggctgaagaaagaatggagtgtgagggcagtagccctgagccagaaccccca
ggaccggctccccagctgcccctggccgtggccacagacaacttcatcagcacttgttcc
tcggcctcccagccctggtcccctagaccaggacctgcccttaacaacaaccccccagct
gtggtggtcagctccccgcaaggctgggctggggagccgtggaaccgggcccagcatagc
cttccccgggcagcggccctggagcggacagagccctcgccgcccccttcagctccccgg
gagtctgatgaggggctgccttgccccggctgctgtcttggccctttcagctttggcttc
ctatccatgtgccctcgccccacaccagctgttgcccgctaccgcaacctgaactgtgag
gcgggcagtctcctctgccaccgagggcaccacgccaagcctcccacacccggtctgcag
ctgcctggggcacgctcttag

DBGET integrated database retrieval system