KEGG   Canis familiaris (dog): 100855579Help
Entry
100855579         CDS       T01007                                 

Gene name
LYPLA2
Definition
lysophospholipase II
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
cfa  Canis familiaris (dog)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:cfa00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 231 aa AA seqDB search
MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAP
RIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGG
FSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVP
VRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtaacaccatgtctgtgcccctgctcaccgatgctgccaccgtgtctggagct
gagcgggaaacggccgcggttatttttttacatggacttggagacacagggcacagctgg
gctgacgccctctccaccatccggctccctcacgtcaagtacatctgtccccatgcaccc
cggatccctgtgactctcaacatgaagatggtgatgccctcctggtttgacctgatgggg
ctaagtccagatgccccagaggacgaggctggcatcaagaaggcagcagagaacatcaag
gccttgatcgagcatgagatgaagaatgggatccctgccaaccgaattgtcctgggaggc
ttttcacagggtggggccctgtccctctacacggcccttacctgtccccaccctctggct
ggcatcgtggcattgagctgttggctgcctctgcaccgggccttcccccaggcagccaat
ggcagcgccaaggacctggccatccttcagtgccatggggagctggaccccatggttcca
gtacggtttggggccctgacggctgagaagctccggtccgttgtcacacctgccagggtc
cagttcaagacttacccaggtgtcatgcacagctcctgtcctcaggagatggcagcggtg
aaggagtttcttgagaagctgctgcctcctgtctaa

DBGET integrated database retrieval system