KEGG   Canis familiaris (dog): 100855769Help
Entry
100855769         CDS       T01007                                 

Gene name
PAICS
Definition
phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
cfa  Canis familiaris (dog)
Pathway
Purine metabolism
Metabolic pathways
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100855769 (PAICS)
Enzymes [BR:cfa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     100855769 (PAICS)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     100855769 (PAICS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 425 aa AA seqDB search
MATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNPLEGKAAISNKT
PSCIFQLLKEAGIKTAFTRMCGETAFIAPKCEMIPIEWVCRRIATGSFLKRNPGVKEGYK
FYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLVIGQTEVDIMSHATQAIFEILEKSW
LPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPE
GLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLSHCEKIQKACGNFGIPCELRVT
SAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISCPPLTPDWGAQ
DVWSSLRLPSGLGCSTILSPEGSAQFAAQIFGLNNHLVWAKLRASILNTWISLKQADKKI
RKGNL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggcggaggtactgaatattggtaaaaaactctatgagggtaaaacaaaagaa
gtctatgaattgctcgatagtccaggaaaagtcctcctgcagtccaaggaccagattaca
gcaggaaatgcagccagaaagaatcccctggaaggaaaagctgcaatctcaaataaaact
cccagttgtatttttcagttgttaaaggaagcaggtatcaaaactgctttcaccagaatg
tgtggggagacagctttcattgcacctaaatgtgagatgattccaattgaatgggtttgt
agaagaatagcaactggttcttttctcaaaagaaatcctggtgtcaaagaaggatataaa
ttttacccacctaaagtggagctgtttttcaaggatgatgccaataatgatccacagtgg
tctgaagaacagctaattgctgcaaaattttgctttgctggacttgttataggccagact
gaagtggatatcatgagtcatgctacacaggctatttttgaaatactggagaaatcctgg
ttgccccaaaactgtacactggttgatatgaagattgaatttggtgttgatgtaaccacc
aaagaaattgttcttgctgatgttattgataatgattcctggagactctggccatcagga
gatcgaagccaacagaaagacaaacagtcatatcgtgacctcaaggaagtaactccagaa
gggctccagatggtgaagaaaaattttgagtgggttgcagaaagagtagagttacttcta
aaatcagaaagtcagtgcagagttgtagtactgatgggctcaacttctgatctcagtcac
tgtgaaaaaatccaaaaggcttgtggaaattttggcattccatgtgaacttcgggtaaca
tctgcccataaaggaccagatgaaactctgaggattaaagcagagtatgaaggggatggc
attcctactgtatttgtggcagtggcaggcagaagcaatggtttgggtccagtgatgtct
ggcaacactgcatacccagttatcagctgccctccactcactccagactggggagctcag
gatgtgtggtcttctcttcgactacccagcggtcttggctgttcgaccatactttcccca
gaaggatcagctcagtttgctgctcagatatttggattaaacaaccatttggtatgggct
aaacttcgagcaagtatattgaacacatggatttccttgaaacaggctgacaagaaaatc
cgaaagggcaatttataa

DBGET integrated database retrieval system