KEGG   Canis familiaris (dog): 100855968Help
Entry
100855968         CDS       T01007                                 

Gene name
GTF3C4
Definition
general transcription factor IIIC, polypeptide 4, 90kDa
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100855968 (GTF3C4)
Transcription machinery [BR:cfa03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     100855968 (GTF3C4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 822 aa AA seqDB search
MSSADKARVGPAADGPAPPEEDEGEGGGEAGGKGPAAEAAPGPSAAFRFLVTRREPAVRL
QYAVSGLEPLAWSEDHRVSVSTARSIAVLELICDVHNPGQDLVIHRTSVPAPLNSCLLKV
GSKAEVAECKEKFATSKDPTVSQTFMLDRVFNPEGKALPPMRGFKYTSWSPMGCDANGRC
LLAALTMDNRLTIQANLNRLQWVQLVDLTEIYGERLYETSYRLSKNEAPEGNLGDFAEFQ
RRHSMQTPVRMEWSGICTTQQVKHNNECRDVGSVLLAVLFENGNIAVWQFQLPFVGKESI
SSCNTIESGINSPSVLFWWEYEHNNRKMSGLIVGSAFGPVKILPVNLKAVKGYFTLRQPV
VLWKEMDQLPVHSIKCVPLYHPYQKCSCSLVVAARGSYVFWCLLLISKAGLNVHNSHVTG
LHSLPIVSMTADKQNGTVYTCSSDGKVRQLIPIFTDVALKFEHQLIKLSDVFGSVRTHGI
AVSPCGAYLAVITTEGMVNGLHPVNKNHQVQFVTLKTFEEAAAQLLESSVQNLFKQVDLI
DLVRWKILKDKHIPQFLQEALEKKIESSGATYFWRFKLFLLRILYQSMQKTPSEALWKPT
HEDSKILLVDSPGMGNAEEEQQEEGPSSKQASRQGLQERSREGDPEDPTEDSLTQSGDAG
GREPMEEKLLEIQGKIEAVEMHLTREHMKRVLGEVYLHTWITENTSIPTRGLCNFLMSDE
EYDDRTARVLIGHISKKMNKQTFPEHCSLCKEILPFTDRKQAVCSNGHIWLRCFLTYQSC
QSLIYRRCLLHDSIARHPAPDDPDWIKRLLQSPCPFCDSPVF
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgagctcggccgacaaggcccgggtggggcccgcggccgacgggcccgcgccgcccgag
gaggacgagggcgaggggggcggcgaggcgggcgggaaggggccggcggcagaggcggcc
cccgggcccagcgcggcgttccgcttcctggtgactcggcgggagccggccgtgaggctg
cagtacgcagtgagcggcttggagccgctggcctggtcggaggaccaccgcgtgtcggtg
tccacggcccgcagcatcgctgtgctggagctcatctgcgacgtgcacaacccgggccag
gacctggtcatccaccgcacgtcggtgcccgcccctctcaacagctgcctcctcaaagtt
ggctcaaaagcagaagttgctgagtgtaaggagaaatttgccacctcgaaagaccccaca
gtcagtcagactttcatgttggacagggtgttcaaccctgaggggaaggcgttgccacca
atgagaggattcaaatatactagttggtcccccatgggttgcgatgcaaatggcaggtgc
ctcttggcagcactgaccatggataatcgcctgaccatccaggctaacctcaatagacta
cagtgggtccagttggttgatctgactgagatttatggagaacgtctttatgagaccagc
tataggctctctaaaaatgaggctccagaggggaatcttggggacttcgcggagtttcag
aggagacatagcatgcagacaccggtcagaatggagtggtcgggcatctgtaccactcag
caggtcaagcataacaacgagtgccgggatgtaggcagtgtgctcctggcagtcctcttt
gaaaatggtaacattgctgtgtggcagtttcagctgccatttgtaggaaaggaatccatc
tcttcttgcaacactattgagtcaggaatcaactctcctagtgttttgttttggtgggaa
tatgagcacaataatcggaaaatgagtggccttattgtggggagtgcttttggacctgta
aaaattcttcctgtcaatctcaaagcagttaaaggctatttcactttaaggcagcctgtt
gtcttgtggaaagaaatggaccagttgccagtgcacagcattaaatgtgttccactttat
cacccttaccaaaagtgtagttgtagcttagtggtggctgcaagaggatcctatgtgttt
tggtgtcttcttctgatctccaaagcaggtctcaatgtccacaattcccatgtcacaggc
cttcactccctgccgattgtctccatgactgcagacaagcagaatggaacagtatatact
tgttctagtgatggtaaggtgaggcagctgattccaattttcaccgatgttgcattaaag
tttgaacaccagttaattaaactctcagatgtgtttggctcagtgaggacacacgggata
gcagtgagcccctgtggtgcgtatctggccgtcattacaactgagggcatggtcaacggc
ctccatcctgtgaacaaaaaccaccaggtccagtttgttactctcaaaacctttgaagag
gcagctgctcagctcctggaatcttcagttcagaatctcttcaagcaagtagatttaata
gatcttgtacgctggaagattttaaaagataaacatatccctcaatttttacaagaagct
ttggaaaaaaagattgaaagcagtggagccacctatttttggcgtttcaaacttttcctc
ctgaggattttgtatcagtcaatgcagaaaaccccttcagaagcattatggaaacccacc
cacgaggactccaaaatcttattagttgactcccctgggatgggcaatgctgaggaagaa
cagcaagaggaaggcccttcttccaaacaggcgagtcggcaaggccttcaggagaggagc
agagaaggtgatccagaggaccccaccgaggattcgctgacccagtctggagatgcaggg
ggccgtgagccaatggaagagaagctcctggagatccaagggaaaattgaagctgtggaa
atgcacttaaccagggagcacatgaagcgcgttttaggggaagtttacctgcacacctgg
atcactgaaaacacaagcatccccaccaggggactctgtaacttcctgatgtctgatgaa
gagtatgatgaccgaacagcacgggtgctgattggacacatctcaaagaagatgaacaaa
cagactttccctgagcactgtagtttgtgtaaagagatcttgccattcacagatcgcaaa
caggcagtctgctccaatggccacatttggctccggtgctttttaacctaccagtcctgc
cagagtctgatatatagaaggtgtttgctccatgacagcattgcccgtcatccagctccg
gacgatcctgactggattaagaggttactgcaaagcccctgccctttctgcgattctcct
gtcttctga

DBGET integrated database retrieval system