KEGG   Canis familiaris (dog): 100855976Help
Entry
100855976         CDS       T01007                                 

Gene name
ADRA2B
Definition
adrenoceptor alpha 2B
Orthology
K04139  
adrenergic receptor alpha-2B
Organism
cfa  Canis familiaris (dog)
Pathway
Neuroactive ligand-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:cfa04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 496 aa AA seqDB search
MDHQEPYSVQATAAIAAVITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADIL
VATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEY
NSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGS
FFAPCLIMILVYLRIYLIAKRSHRRGPRAAGGRGEGESKQPHSVPTAASTKLPTLASLAA
SGEANGHSKPTGEKEEGDTSEDPGTPALPPSWSAVPNPGQSQKEGVCGASPEEEAEMEEG
EEECEPQALPASPAAACSPPLRQPQGSRVLATLRGQVLLGRGVGTTSGQWWRRRAQLTRE
KRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPQHCKVPHGLFQFFFWIGYCNSSLNPVIY
TIFNQDFRRAFRRILCRQWTQTAWXATCPPPMWGWCGGTRATLILXLFYVATSLGLSGPA
DLILGAPWEGQGQGCC
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggaccaccaggagccctactcggtgcaggccaccgcggccatcgcggcggtcatcacg
ttcctcatcctcttcaccatcttcggcaacgcgctggtcatcctggccgtgttgacgagc
cgctcgctgcgcgccccgcagaacctgttcctggtgtcgctggccgcagccgacatcctg
gtggccacgctcatcatccccttctcgctggccaacgagctgctgggctactggtacttc
cggcgcacgtggtgcgaggtgtacttggcgctcgacgtgctcttctgcacctcgtccatc
gtgcacctgtgcgccatcagcctggaccgctactgggccgtgagtcgcgcgctcgagtac
aactccaagcgcaccccgcgccgcatcaagtgcatcatcctcaccgtgtggctcatcgca
gcggtcatctccctgccgccgcttatctacaagggcgaccaggggccccagccccgcggg
cgcccacagtgcaaactcaaccaagaagcctggtacatcctggcctctagcatcggctcc
ttctttgcaccctgcctcatcatgatccttgtctacctgcgcatctacttgatcgccaaa
cgcagtcaccgcagaggtcccagggccgcggggggccgcggggagggtgagtccaagcag
ccgcactcggtccccacggcagcttcaaccaaactgccaaccctggcctctctggctgct
tctggagaggccaatggacactcgaagcctactggggagaaggaagagggcgatacctct
gaagatccggggacccctgccttgccacccagctggtcagccgttcccaacccaggccag
agtcagaaggaaggcgtgtgtggggcatctccagaggaggaagccgagatggaggaaggg
gaggaagagtgtgagcctcaggccttaccggcgtctcctgcggcagcttgtagcccaccc
ctgcggcagccacagggttctcgggtgctggcaactctacgtggccaggtgctcctgggc
aggggtgtgggcaccacgagcgggcagtggtggcgtcggcgggcacagctgaccagggag
aagcggttcacctttgtgctggccgtggtcattggtgtttttgtgctctgctggttccct
ttcttcttcagctacagcctgggtgccatctgcccacagcactgcaaggtgccccatggt
ctcttccagttcttcttctggattggctactgtaacagctcgctgaaccctgtcatctat
accatctttaaccaggactttcgccgtgccttccgaaggatcctctgccgccagtggacc
cagacggcatggtgagccacctgcccgccacccatgtggggttggtgcggtggcaccagg
gccactctgattcttnccctgttttatgtggccacctcgctggggctttctggtcctgca
gacctcatcttgggagccccctgggagggacaggggcaggggtgctgttag

DBGET integrated database retrieval system