KEGG   Canis familiaris (dog): 100856000Help
Entry
100856000         CDS       T01007                                 

Definition
chymosin-like
Orthology
K01378  
chymosin [EC:3.4.23.4]
Organism
cfa  Canis familiaris (dog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 381 aa AA seqDB search
MRCLVVLLAVLALSQGSGVTRVPLHKGKSLRKALKEHGLLEDFLKKHPYAISRKYSNLEK
VASEPLANYLDCQYFGRISIGTPPQEFTVVFDTGSSDLWVPSVYCKSTACQSHHRFDPAK
SSTFQNLNEPLSIQYGTGSMQGFLGLDTVTVSSIVDPQQTVGLSTQEPGSIFTYSEFDGI
LGLAYPSLASPYSVPVFDNMMQNHLVAQDLFSVYLSRNGQGSMLTLGAIDPTYYTGALHW
VPVTVEEYWQFTVDSVTVNGVVVACDGGCQAILDTGTSMLVGPNSDILNIQSAIGATQDQ
YGMFDINCGNLGSMPSVVFEIHGRKYPLPPSAYTSQDMGFCSSGFQGEGDSQLWILGDVF
IREYYSVFDRVNNRLGLAKAI
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaggtgtctcgtggtgctacttgcagtcctcgccctctcccagggcagtggggtcacc
agggtccctctgcacaaaggcaagtcgctgagaaaggccctgaaggagcatgggctccta
gaggacttcctgaagaaacacccgtatgccatcagcaggaagtactcaaatttagagaag
gtggccagcgagcccttggccaactacctggactgtcagtacttcgggaggatctccatt
gggaccccaccccaggaattcaccgtggtgtttgacaccggctcctccgacctctgggtg
ccctctgtctactgcaagagtactgcctgccaaagccatcaccgcttcgacccagccaag
tcctccaccttccagaacctgaatgagcccctgtccatccagtacggcacgggcagcatg
cagggctttctgggccttgatactgtcactgtctccagcattgtggacccccagcagact
gtgggcctgagcactcaggagcctggcagcatctttacctactctgagttcgatggcatc
ctggggctggcctacccctctctcgcctccccgtactcagtgcctgtgtttgacaacatg
atgcagaatcacctggtggcccaagacctgttctctgtgtatttgtccaggaatggccag
gggagcatgctgacgctgggagccatagacccgacctactacacaggcgccctgcactgg
gtgcccgtgaccgtggaggagtactggcagttcaccgtggacagcgttactgtcaatggt
gtggtggtggcctgtgatggtggctgtcaggccatcctggacacaggcacctctatgctg
gttgggcccaacagcgacatcctcaacatccagtcagccattggagccacacaggaccaa
tatgggatgtttgacatcaactgcgggaacctgggcagcatgccttcggtggtctttgag
atccacggcagaaagtacccactgcccccgtctgcctacaccagccaggatatgggcttc
tgctccagtggcttccagggtgaaggcgattcccagctgtggatcctgggggatgtcttc
atccgggagtattacagcgtctttgacagagttaacaaccgcctgggactggccaaggcc
atctga

DBGET integrated database retrieval system