KEGG   Canis familiaris (dog): 100856068Help
Entry
100856068         CDS       T01007                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B31-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00040  Pentose and glucuronate interconversions
cfa00053  Ascorbate and aldarate metabolism
cfa00140  Steroid hormone biosynthesis
cfa00830  Retinol metabolism
cfa00860  Porphyrin and chlorophyll metabolism
cfa00980  Metabolism of xenobiotics by cytochrome P450
cfa00982  Drug metabolism - cytochrome P450
cfa00983  Drug metabolism - other enzymes
cfa01100  Metabolic pathways
cfa05204  Chemical carcinogenesis
Module
cfa_M00014  Glucuronate pathway (uronate pathway)
cfa_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100856068
   00053 Ascorbate and aldarate metabolism
    100856068
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100856068
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100856068
   00860 Porphyrin and chlorophyll metabolism
    100856068
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100856068
   00982 Drug metabolism - cytochrome P450
    100856068
   00983 Drug metabolism - other enzymes
    100856068
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100856068
Enzymes [BR:cfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100856068
Glycosyltransferases [BR:cfa01003]
 Others
  Hydrophobic molecule
   100856068
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 100856068
NCBI-ProteinID: XP_003639508
Ensembl: ENSCAFG00000029376
Position
13
AA seq 530 aa AA seqDB search
MSMKWISVLLLLQLSCYFSSGSCGKVLVWPTEYSHWINVKTILDELVQRGHEVTVLTSSA
SILVDPNKLSAIKFEIYSAHLSRGDFEALFTKMLKMWTYDMPKDSFWAYFSVMQEILWEY
YECVEKLCKDVVLNKKLMTKLQESKFDVILADAVGPCGELLAELLKIPLVYSLRFSPGYA
FEKHRGGLPLPPSYVPVILSELTDQMTFMERVKNMLYVLYFDFWFQTINEKSWDQFYSEV
LGRPTTLYELMRKADIWLIRTYWDLEFPRPLLPHFDFVGGLHCKPAKPLPKEMEEFVQSS
GENGIVVFSLGSMINNMPEERANVIASALAQIPQKVLWRFDGKKPDNLGRNTRLYKWIPQ
NDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQADNIVHMKAKGAAIRLDLST
MSSADLLDALRTVINDPSYKENAMKLSGIHHDQPIKPLDRAVFWIEYVMRHQGAKHLRPA
SHDLTWFQYHSLDVIGFLLACVATAIFVTTQCCLFCCRKVAKTGKKIKKE
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgaaatggatttcagtgcttctgctgctacagctgagctgttactttagctct
gggagttgcgggaaggtgctggtgtggcccacggaatacagccactggatcaatgtaaag
acaatcctggatgaacttgtccagaggggtcatgaagtgactgttctgacatcgtcagct
tccattcttgttgatccgaacaaattatctgctattaaatttgagatttactctgcacat
ttatctagaggtgattttgaggctttgttcactaaaatgctcaagatgtggacatatgat
atgccaaaagattcattttgggcgtatttttcagtaatgcaagaaattctttgggaatat
tatgagtgtgttgagaagctctgtaaagatgtagttttgaacaagaaactcatgacaaaa
ctacaagaatcaaagttcgatgtcattcttgcagatgctgtcggaccctgcggtgagctg
ctggctgagctccttaaaatacctttagtgtacagtctccgtttctctccaggctacgca
tttgagaaacaccgtggaggacttcctctccctccatcctacgtacctgttattctgtca
gaattaactgatcaaatgacattcatggagagagtaaaaaatatgctgtatgtgctttat
tttgacttttggttccaaacaataaatgagaagagttgggatcagttttacagcgaagta
ctaggaagacctactacactatatgagttaatgaggaaagctgatatatggctcattcga
acctactgggatttggaatttcctcgcccactcctaccacattttgactttgttggaggc
ctacactgcaaacctgccaaacccctgcctaaggaaatggaagagtttgtccagagctct
ggagaaaacggtattgtggtgttttctctagggtcaatgatcaataacatgccagaggaa
agagccaatgtgatcgcatcagcccttgcccagattccacaaaaggttctatggagattt
gatggcaagaaaccagacaacttagggcgaaatactcggctgtataagtggattccccag
aatgaccttcttggtcatccgaaaaccaaagcctttataacccatggtggaaccaacggc
atctatgaggcgatctaccacgggatccccatggtgggcattcccttgtttgccgatcaa
gctgataacattgttcacatgaaagctaagggagcagctatcagactggacttgagcaca
atgtctagtgcagacttgctcgatgcattgaggacggtcattaatgacccttcgtacaaa
gagaatgctatgaagttatcaggaattcaccacgatcagcctataaagcccctggaccgg
gcagtcttctggatcgagtatgtcatgcgccaccaaggagccaagcacctgcggccagcc
tcccatgacctcacctggttccagtaccactccttggatgtgattgggtttctgctggcc
tgtgtggcaactgctatatttgtcaccacacaatgttgtctgttttgttgtcggaaggtc
gcaaaaactgggaagaagataaaaaaggagtag

DBGET integrated database retrieval system