KEGG   Canis familiaris (dog): 100856129Help
Entry
100856129         CDS       T01007                                 

Definition
UDP-glucuronosyltransferase 2A3-like
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
cfa  Canis familiaris (dog)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:cfa00040]
Metabolism; Carbohydrate metabolism; Ascorbate and aldarate metabolism [PATH:cfa00053]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cfa00500]
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:cfa00140]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:cfa00830]
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cfa00860]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:cfa00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:cfa00982]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:cfa00983]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:cfa05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
13
AA seq 529 aa AA seqDB search
MMSTKWISAIVLLQLCYTGCGFCGKVLVWPCDMSPWLNIKIILEKLTERGHEVTVLVSPQ
SFIIDYNKPSTLKFEVIPMPHDREAAEKSLDHFLDIATNVMPTLSHWQSALKLDEFLFQD
DGNFKLCETVVYNQSIMKKLREANYNVMVIDPALPCGELIAELLGVPFVYTVRFSIGDTV
EKYCGKLPAPLSYVPVTMAALTDRMTFLQRVKNLMYSIFFKFWIHQHDNPFWDQFYSEVL
GRPTTLCEIMGKAEIWLIRTYWDFEFPRPYLPNFEFVGGLHCKPAKPLPKGIEEFVRSSG
EDGVVVFSLGSMVKNLTDEKANLIASALAQIPQKVLWRYKGNKPATLGTNTRLYDWIPQN
DLLGHPKTKAFITHGGTNGIYEAIYHGVPMVGVPLFADQPDNIAHMKAKGAAVEVNINTM
TSADLLHALRTVINEPSYKENATRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRPAS
HDLTWFQYHSLDVIGFLLACVATAIFLVTKCCLFSCRKFNKAGKKKKRE
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgatgtctacaaaatggatttcagcaattgtgctgctgcagctttgctacactggctgt
ggattctgtgggaaggtcctggtgtggccctgtgacatgagcccttggctcaatataaag
attattctggagaaactcacagaaaggggccatgaggtgactgtgttggtgtctccacag
agtttcatcattgactacaacaagccttccacactgaaatttgaggtgatccccatgcca
cacgacagagaggctgctgaaaagtcgctagatcattttttagacatagctactaatgtt
atgccaacattgtcacactggcagtcagcattaaaactggacgaattcttatttcaagat
gatggaaatttcaaactgtgtgagactgtagtctacaaccagtcaatcatgaagaaactc
cgggaagctaactacaatgtaatggtcatagaccctgcattaccctgtggagagctgatt
gctgaactactgggggtcccttttgtgtatacggtaaggttctctattggtgacactgtg
gaaaaatactgtgggaagcttccagctccactttcctatgttcctgttaccatggcggca
ctaacagacagaatgacttttctgcaaagggtaaaaaatttaatgtactccattttcttt
aagttctggatccaccaacatgacaatccattttgggaccagttttacagtgaagtatta
ggaagacccactacattatgtgagattatggggaaagcagaaatttggttaatccgaaca
tattgggattttgaatttcctcgcccatacttacctaattttgagtttgtaggagggttg
cactgtaaacctgccaagccattacctaagggaatagaggaatttgtccgaagttcaggt
gaagatggtgttgtggtgttttctctggggtcaatggtcaaaaatctcacagatgaaaag
gccaatctcattgcctcggctcttgcccagattccacagaaggttttatggagatacaaa
ggaaacaaaccagccacgttgggaaccaatactcggctctatgactggataccccagaat
gatcttcttggtcatcccaaaacaaaagcttttatcactcacggtggaaccaatgggatc
tatgaagctatttatcacggggttcctatggtgggagtgcctttgtttgctgatcagcct
gacaacatcgctcacatgaaggccaaaggagcagctgtggaggtgaacatcaacacaatg
accagtgcagatctgctccatgccctgagaacagtcattaatgaaccttcttataaagag
aatgctacaagattatcgaggattcaccatgatcaacctgtaaagcccctggaccgagca
gtcttctggattgagtttgtcatgcgccacaaaggagccaagcacctgcggccagcctcc
catgacctcacctggttccagtaccactccttggatgtgattggattcctgctggcctgt
gtggcgactgctatattcttggtcacaaaatgttgtttgttttcttgtcgaaaatttaat
aaagcaggaaagaagaaaaagagggagtag

DBGET integrated database retrieval system