KEGG   Canis familiaris (dog): 100856354Help
Entry
100856354         CDS       T01007                                 

Gene name
ARHGEF1
Definition
Rho guanine nucleotide exchange factor (GEF) 1
Orthology
K12330  
Rho guanine nucleotide exchange factor 1
Organism
cfa  Canis familiaris (dog)
Pathway
Vascular smooth muscle contraction
Platelet activation
Regulation of actin cytoskeleton
Pathways in cancer
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100856354 (ARHGEF1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100856354 (ARHGEF1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    100856354 (ARHGEF1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100856354 (ARHGEF1)
   05205 Proteoglycans in cancer
    100856354 (ARHGEF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 916 aa AA seqDB search
MEADNVARGLAPGPPRPGLVPVSIIGAEDEDFENELETNTEEQNSQFQSLEQVKRRPAHL
MALLQHVALQFEPGPLLCCLHADMLSSLGPKEAKKAFLDFCHCFLDKTAVLRVLVPPAVA
FELDRTRPEVISEDLQRQFVQEVVQSQQAAVSRLLEDFRSKRLMGMTPWEQDLTQLEAWV
GRDRASFEARERHLAERLLAHLEEMQHTISNDEEKSAAVVNAISLYMRHLGVRTKSGDKK
SGMNFFRKKVMGNRRSDEPTKTKKGLSIFLDPARWNRGEPQASDFRHLKVETDAEKPGLT
ERKGGLGVPSRDRNVGAPGQDVPGVSLHPLPGDSPDREPGVDTPPELGDPPPQGPASLEP
PGPSESTEEGPDTESPEPGDEGDPGRSGLELEPEEPPGWRELIPPGTLHSLPKSQVKRQE
VISELLVTEAAHVRMLRVLHDLFYQPMLEGNFFSTEDLQNIFPSLDELIEVHSLFLDRLM
KRRQDSGCLIEEIGDVLLARFDGAEGKWFQKISSRFCSRQSFALEQLKAKQRKDPRFCAF
VQEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEESAEREKVELAAECCREIL
HHVNQAVRDMEDLLRLKDYQKRLDLSLLRQSSDPMLSEFKNLDITKKKLIYEGPLTWRLT
KDKAVEVHVLLLDDLLLLLQRQDDRLLLKSHSRTLTPTPDGKTMLRPVLRLTSAITREVA
TDHKAFYVLFTWDQEAQIYELVAQTVSERKNWCSLITETAGSLKVPAPASRPKPRPSPSS
TREPLLSSSENGNGGGREMPPADGQTERILSTLLPYCRPRPEGQLAAKALEKVLSLKQLL
FPSEEDSGAGPPQEGDGVPGGGPLNPTQTHTQEIREKLLSLEETMKQLEEVEEEFCHLRL
LLSQLGENSTPQPGCT
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagacaacgttgcccgagggctggcaccaggaccaccgcggcctggcctggtg
ccagtcagcatcattggggctgaggacgaggattttgagaatgagctggagacgaacaca
gaggagcaaaacagccagttccagagcctggagcaggtgaagcggcggcctgcccacctc
atggccctcttgcagcacgtcgccctgcagtttgaaccaggacctctgctctgctgcctg
cacgcggacatgctgagttccctgggccccaaggaggccaagaaggccttcctcgacttc
tgccattgcttcctggacaagacggcggttttgcgggtgctagtccctcccgccgtcgcc
tttgaacttgaccgcacgcggcccgaggtcatctccgaggacttgcagcggcagtttgta
caggaggtagtgcagagccagcaggcagctgttagccggctgctggaggacttccgctcc
aagcggctcatgggcatgacaccctgggagcaggacctgacccagctggaggcctgggtt
gggcgggaccgtgccagctttgaggcccgggagcggcacctggctgaacggctgctggcc
cacctggaggagatgcaacacaccatctctaacgatgaggaaaagagtgccgctgtggtc
aatgccatcagcctgtacatgcgccaccttggggtgcggaccaagagcggagacaagaag
tcagggatgaatttcttccgcaaaaaggtgatggggaatcggcggtcagatgagccaacc
aagaccaaaaaaggcctgagcatcttcctagaccctgctcgctggaaccggggagagcct
caggcctcggatttccgacacctcaaagtcgagactgatgctgagaaaccaggccttacg
gaaaggaagggaggcctgggggtgccctcccgggaccggaatgttggggctcctgggcag
gatgtccctggagtttctctgcaccctctgcccggggacagccctgaccgggaaccaggt
gttgacaccccgccagagctgggggacccacccccccagggcccggccagcctggagccc
ccggggccctcggagagcactgaggagggtcctgacacagagagccctgagcctggagac
gaaggggaccctgggcggtcaggactagagctggaaccagaagagccccctggctggcgg
gagctcatccccccaggcaccctgcacagcctgcctaagagccaggtgaagcggcaggag
gtcatcagcgagctactggtgacagaggctgcccatgtgcgcatgctccgggtgctgcat
gacctcttctaccagcccatgttggaagggaacttcttctccacggaggatctacagaac
atcttccccagcctggatgagctcatcgaggtgcattccctgttcctcgatcgactgatg
aagcggaggcaggatagtggctgcctcattgaggagatcggagatgtactgctggcccgg
tttgatggtgccgaaggcaaatggttccagaaaatctcctcccgcttctgcagccgccag
tcatttgccttagagcagctcaaagccaagcagcgcaaggatcctcggttctgtgccttt
gtgcaggaggccgagagccgcccccggtgccgccgcctgcagctgaaggatatgatcccc
acggagatgcagcgtctgaccaagtaccccctgctcctgcagagcattgggcagaacaca
gaagagtcagcagaacgggagaaagtagaactggcagctgagtgctgccgggaaattctg
caccatgttaaccaagccgtgcgtgacatggaggacctgctgcggctcaaggattatcag
aagcgcctggacttgtccctcctgcggcagagcagcgaccccatgctaagcgagttcaag
aacctggacatcaccaaaaagaagctgatctacgagggtccgctgacgtggcggctgacg
aaggacaaggctgtagaggtacacgtgctgctgctggatgacctgctgctgctgctccag
cgccaggacgatcggctgctgctcaagtcccacagccggacgctgacacccacacccgac
ggcaagaccatgctgcggccggtgctgcggctcacctccgccataacccgcgaggtggct
accgatcacaaagccttctatgtcctttttacctgggaccaggaggcccagatatatgag
ctggtggcccagacggtgtcggaacggaagaactggtgttccctcatcactgaaactgct
ggatccttgaaggtccctgcccccgcctctcgccccaaaccccggcccagcccaagcagc
acccgagaacccctgctcagcagctcagagaatggcaacggtggtggccgagagatgccc
ccagctgacggccagacggagagaatcctcagcaccctcctgccctactgcaggccccgc
cctgagggccagcttgctgccaaggcccttgagaaagtgctgtccctgaagcagctcctg
tttccctcggaggaagacagtggggcagggcctccccaggaaggggatggggtccctggg
ggtggccccctgaacccgacacagacccacacccaggaaattcgggaaaagctgctcagc
ctggaggagaccatgaaacagctggaggaggtggaggaggaattttgtcacctgcgactc
ctcctgtctcagcttggggagaacagcaccccccagcctgggtgtacctga

DBGET integrated database retrieval system