KEGG   Canis familiaris (dog): 100856518Help
Entry
100856518         CDS       T01007                                 

Definition
glutathione S-transferase theta-1-like
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
cfa  Canis familiaris (dog)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100856518
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100856518
   00982 Drug metabolism - cytochrome P450
    100856518
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100856518
Enzymes [BR:cfa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100856518
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
26
AA seq 240 aa AA seqDB search
MGLELYLDLLSQPCRAVYIFAKKNGIPFELRPVELLKGQHHSDAFAQVNPLKKVPALKDG
DFTLAESVAILLYLSRKYEVPDHWYPQDLQARARVDEYLAWQHTTLRSSCTRAMWQKMMS
PVFLGEQVPAETLVSTLAELDRCLQLLEDKFLKDQDFLAGPHISVADLVAITELMHPVSA
GCQIFKSRPKLAAWRQRVEAEVGKDLFQEAHAVVLKAKDLPPADTSIKEKLKPSVQVLLR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgggcctggagctgtacctggacctgctgtcccagccctgccgcgccgtctacatcttc
gccaagaagaacggcatccccttcgagctgcgccccgtcgagctgctcaaaggccaacac
cacagcgatgcttttgcccaggtgaatcctctgaagaaggtgccagctttgaaggatgga
gacttcaccttggctgaaagtgtggccatcctgttgtatctgagtcgcaagtatgaggtc
cccgaccactggtacccccaggacctgcaggcccgcgcccgtgtggacgagtacctagca
tggcagcacaccaccctcaggagtagctgtacccgagccatgtggcagaagatgatgtcc
ccagtgttcctgggtgaacaggtacccgctgagacattggtctctactctggccgagctg
gacaggtgcctgcagctgcttgaggacaagttcctaaaggaccaggacttccttgctgga
ccccacatttcagtggctgacttggtggccatcacagagctgatgcatcctgtcagtgca
ggctgccaaatcttcaaaagccgacccaagctggctgcatggcgccaacgtgtggaggcc
gaggtggggaaggacctctttcaggaggcacatgcagttgtcctgaaggccaaggacttg
ccaccggccgacacctccatcaaggagaagctgaagccctcggtgcaggttttgttgcgg
tga

DBGET integrated database retrieval system