KEGG   Canis familiaris (dog): 403403Help
Entry
403403            CDS       T01007                                 

Gene name
PLA2G15, ACS, LLPL, LPLA2, LYPLA3
Definition
phospholipase A2, group XV (EC:2.3.1.-)
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
cfa  Canis familiaris (dog)
Pathway
Glycerophospholipid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    403403 (PLA2G15)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    403403 (PLA2G15)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     403403 (PLA2G15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 408 aa AA seqDB search
MGLRRGPCPAALLPGGFLFLLLLADPALLAGRRPPVVLVPGDLGNQLEAKLDKPTVVHYL
CSKRTESYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGKTFSL
EFLDPSKSSVGSYFHTMVESLVDWGYIRGEDVRGAPYDWRRAPNENGPYFLALREMIEEM
YQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKNKYIQAFVALGAPWGGVAKTLRVLASGD
NNRIPVIRPLKIREQQRSAVSTSWLLPYNYTWSPEKIFVHTPTANYTLRDYHQFFQDIGF
KDGWLMRQDTEGLVEAMVPPGVPLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVN
LQSALQCQAWRGHQEHQVSLQALPGSEHIEMLANATTLAYLKRVLLGP
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgggccttcgccgcggtccctgccctgcggcgctgctcccggggggcttcctgttcctc
ctgctgctggcagacccggcgctcctcgctggacgccgccctccggtggtgctagtgcct
ggtgatttgggcaaccagctggaggcaaagctagacaagccaacggttgtgcactacctc
tgctccaagaggacggaaagctacttcacactctggctgaatctcgaactgctgctgcct
gtcatcattgattgctggattgacaatatcaggctggtctacaacagaacatcccgggcc
acccagttcccagatggtgtggatgtacgcgtgcctggctttggaaagactttctcactg
gagttcctggaccccagcaaaagtagtgtgggttcctatttccataccatggtagagagc
cttgtggactggggctatatacggggtgaggatgtccggggtgccccctacgactggcgc
cgagccccaaatgaaaacgggccctacttcctggccctccgggagatgatcgaggagatg
taccagctgtatgggggacctgtggtgctggttgcccacagcatgggcaacatgtacaca
ctctactttctgcagcggcagccacaggcctggaagaacaagtatattcaagcatttgtg
gcactgggtgcgccctggggtggcgtggccaagactttgcgtgtcctggcctcaggagac
aacaatcggatccccgtcattaggcccctgaagatccgggagcagcagcgctcagccgtc
tccaccagctggctgctgccttataactacacctggtcacctgaaaagatcttcgtgcat
acgcccacagccaactacacgctgcgggactatcaccagttcttccaggatattggcttc
aaagatggatggctcatgcggcaggacacggaggggctggtggaagccatggtgccgccc
ggcgtgccgctgcactgcctctatggcactggtgtccccacgccagactccttctactat
gagagcttcccagaccgtgatcccaaaatctgctttggcgacggtgacggcaccgtgaac
ttgcagagtgccctgcagtgccaggcctggcgtggccaccaggagcaccaagtgtctttg
caggcactgccaggcagcgagcacatagagatgctggccaatgccactaccttggcctat
ctgaaacgtgtgctccttgggccctga

DBGET integrated database retrieval system