KEGG   Canis familiaris (dog): 403461Help
Entry
403461            CDS       T01007                                 

Gene name
BDNF
Definition
brain-derived neurotrophic factor
Orthology
K04355  
brain-derived neurotrophic factor
Organism
cfa  Canis familiaris (dog)
Pathway
MAPK signaling pathway
cAMP signaling pathway
Neurotrophin signaling pathway
Huntington's disease
Cocaine addiction
Alcoholism
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    403461 (BDNF)
   04024 cAMP signaling pathway
    403461 (BDNF)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    403461 (BDNF)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    403461 (BDNF)
  Substance dependence
   05030 Cocaine addiction
    403461 (BDNF)
   05034 Alcoholism
    403461 (BDNF)
Cytokines [BR:cfa04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass II
    403461 (BDNF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
21
AA seq 247 aa AA seqDB search
MTILFLTMVISYFGCMKAAPMKEASVRGQGSLAYPGVRTHGTLESVSGPKAGSRGLTSLA
DTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAA
NMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQY
FYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCT
LTIKRGR
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccttttccttactatggttatttcatacttcggttgcatgaaggctgccccc
atgaaagaagcgagcgtccgaggacaaggcagcttggcctacccaggtgtgcggacccat
gggactctggagagcgtgagtgggcccaaggcgggttccagaggcctgacgtcgttggcc
gacacttttgaacacgtgatagaagagctgttggacgaggaccagaaggttcggcccaat
gaagagaacaataaggacgcggacttgtatacctcccgggtgatgctcagcagtcaagtg
cctttggagcctcctcttctctttctgcttgaggaatacaaaaattacctggatgctgca
aacatgtcgatgagggtccggcgccactccgaccccgcccgccgcggggagctgagcgtg
tgcgacagcattagcgagtgggtgacagcggcagacaaaaagactgcagtggacatgtcg
ggcgggacggtcaccgtcctcgaaaaagtccctgtgtcgaaaggccaactgaagcagtac
ttctacgagaccaagtgcaatcccatgggttacacgaaggagggctgcaggggcatagac
aaaaggcattggaactcccagtgccgaactacccagtcgtacgtgcgggcccttaccatg
gatagcaaaaagagaattggctggcggttcataaggatagacacttcctgtgtgtgtaca
ctgaccattaagaggggaagatag

DBGET integrated database retrieval system