KEGG   Canis familiaris (dog): 403461Help
Entry
403461            CDS       T01007                                 

Gene name
BDNF
Definition
brain-derived neurotrophic factor
Orthology
K04355  
brain-derived neurotrophic factor
Organism
cfa  Canis familiaris (dog)
Pathway
MAPK signaling pathway
Neurotrophin signaling pathway
Huntington's disease
Cocaine addiction
Alcoholism
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:cfa04010]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:cfa04722]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:cfa05016]
Human Diseases; Substance dependence; Cocaine addiction [PATH:cfa05030]
Human Diseases; Substance dependence; Alcoholism [PATH:cfa05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
21
AA seq 247 aa AA seqDB search
MTILFLTMVISYFGCMKAAPMKEASVRGQGSLAYPGVRTHGTLESVSGPKAGSRGLTSLA
DTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAA
NMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQY
FYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCT
LTIKRGR
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccttttccttactatggttatttcatacttcggttgcatgaaggctgccccc
atgaaagaagcgagcgtccgaggacaaggcagcttggcctacccaggtgtgcggacccat
gggactctggagagcgtgagtgggcccaaggcgggttccagaggcctgacgtcgttggcc
gacacttttgaacacgtgatagaagagctgttggacgaggaccagaaggttcggcccaat
gaagagaacaataaggacgcggacttgtatacctcccgggtgatgctcagcagtcaagtg
cctttggagcctcctcttctctttctgcttgaggaatacaaaaattacctggatgctgca
aacatgtcgatgagggtccggcgccactccgaccccgcccgccgcggggagctgagcgtg
tgcgacagcattagcgagtgggtgacagcggcagacaaaaagactgcagtggacatgtcg
ggcgggacggtcaccgtcctcgaaaaagtccctgtgtcgaaaggccaactgaagcagtac
ttctacgagaccaagtgcaatcccatgggttacacgaaggagggctgcaggggcatagac
aaaaggcattggaactcccagtgccgaactacccagtcgtacgtgcgggcccttaccatg
gatagcaaaaagagaattggctggcggttcataaggatagacacttcctgtgtgtgtaca
ctgaccattaagaggggaagatag

DBGET integrated database retrieval system