KEGG   Canis familiaris (dog): 403556Help
Entry
403556            CDS       T01007                                 

Gene name
PRKACA
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa01522  Endocrine resistance
cfa04010  MAPK signaling pathway
cfa04014  Ras signaling pathway
cfa04020  Calcium signaling pathway
cfa04024  cAMP signaling pathway
cfa04062  Chemokine signaling pathway
cfa04114  Oocyte meiosis
cfa04140  Autophagy - animal
cfa04211  Longevity regulating pathway
cfa04213  Longevity regulating pathway - multiple species
cfa04261  Adrenergic signaling in cardiomyocytes
cfa04270  Vascular smooth muscle contraction
cfa04310  Wnt signaling pathway
cfa04340  Hedgehog signaling pathway
cfa04371  Apelin signaling pathway
cfa04530  Tight junction
cfa04540  Gap junction
cfa04611  Platelet activation
cfa04713  Circadian entrainment
cfa04714  Thermogenesis
cfa04720  Long-term potentiation
cfa04723  Retrograde endocannabinoid signaling
cfa04724  Glutamatergic synapse
cfa04725  Cholinergic synapse
cfa04726  Serotonergic synapse
cfa04727  GABAergic synapse
cfa04728  Dopaminergic synapse
cfa04740  Olfactory transduction
cfa04742  Taste transduction
cfa04750  Inflammatory mediator regulation of TRP channels
cfa04910  Insulin signaling pathway
cfa04911  Insulin secretion
cfa04912  GnRH signaling pathway
cfa04913  Ovarian steroidogenesis
cfa04914  Progesterone-mediated oocyte maturation
cfa04915  Estrogen signaling pathway
cfa04916  Melanogenesis
cfa04918  Thyroid hormone synthesis
cfa04919  Thyroid hormone signaling pathway
cfa04921  Oxytocin signaling pathway
cfa04922  Glucagon signaling pathway
cfa04923  Regulation of lipolysis in adipocytes
cfa04924  Renin secretion
cfa04925  Aldosterone synthesis and secretion
cfa04926  Relaxin signaling pathway
cfa04927  Cortisol synthesis and secretion
cfa04928  Parathyroid hormone synthesis, secretion and action
cfa04934  Cushing's syndrome
cfa04961  Endocrine and other factor-regulated calcium reabsorption
cfa04962  Vasopressin-regulated water reabsorption
cfa04970  Salivary secretion
cfa04971  Gastric acid secretion
cfa04976  Bile secretion
cfa05012  Parkinson's disease
cfa05020  Prion diseases
cfa05030  Cocaine addiction
cfa05031  Amphetamine addiction
cfa05032  Morphine addiction
cfa05146  Amoebiasis
cfa05165  Human papillomavirus infection
cfa05166  HTLV-I infection
cfa05169  Epstein-Barr virus infection
cfa05200  Pathways in cancer
cfa05203  Viral carcinogenesis
cfa05205  Proteoglycans in cancer
cfa05414  Dilated cardiomyopathy (DCM)
Module
cfa_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    403556 (PRKACA)
   04010 MAPK signaling pathway
    403556 (PRKACA)
   04310 Wnt signaling pathway
    403556 (PRKACA)
   04340 Hedgehog signaling pathway
    403556 (PRKACA)
   04371 Apelin signaling pathway
    403556 (PRKACA)
   04020 Calcium signaling pathway
    403556 (PRKACA)
   04024 cAMP signaling pathway
    403556 (PRKACA)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    403556 (PRKACA)
  Cell growth and death
   04114 Oocyte meiosis
    403556 (PRKACA)
  Cellular community - eukaryotes
   04530 Tight junction
    403556 (PRKACA)
   04540 Gap junction
    403556 (PRKACA)
 Organismal Systems
  Immune system
   04611 Platelet activation
    403556 (PRKACA)
   04062 Chemokine signaling pathway
    403556 (PRKACA)
  Endocrine system
   04911 Insulin secretion
    403556 (PRKACA)
   04910 Insulin signaling pathway
    403556 (PRKACA)
   04922 Glucagon signaling pathway
    403556 (PRKACA)
   04923 Regulation of lipolysis in adipocyte
    403556 (PRKACA)
   04912 GnRH signaling pathway
    403556 (PRKACA)
   04913 Ovarian Steroidogenesis
    403556 (PRKACA)
   04915 Estrogen signaling pathway
    403556 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    403556 (PRKACA)
   04921 Oxytocin signaling pathway
    403556 (PRKACA)
   04926 Relaxin signaling pathway
    403556 (PRKACA)
   04918 Thyroid hormone synthesis
    403556 (PRKACA)
   04919 Thyroid hormone signaling pathway
    403556 (PRKACA)
   04928 Parathyroid hormone synthesis, secretion and action
    403556 (PRKACA)
   04916 Melanogenesis
    403556 (PRKACA)
   04924 Renin secretion
    403556 (PRKACA)
   04925 Aldosterone synthesis and secretion
    403556 (PRKACA)
   04927 Cortisol synthesis and secretion
    403556 (PRKACA)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    403556 (PRKACA)
   04270 Vascular smooth muscle contraction
    403556 (PRKACA)
  Digestive system
   04970 Salivary secretion
    403556 (PRKACA)
   04971 Gastric acid secretion
    403556 (PRKACA)
   04976 Bile secretion
    403556 (PRKACA)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    403556 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    403556 (PRKACA)
  Nervous system
   04724 Glutamatergic synapse
    403556 (PRKACA)
   04727 GABAergic synapse
    403556 (PRKACA)
   04725 Cholinergic synapse
    403556 (PRKACA)
   04728 Dopaminergic synapse
    403556 (PRKACA)
   04726 Serotonergic synapse
    403556 (PRKACA)
   04720 Long-term potentiation
    403556 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    403556 (PRKACA)
  Sensory system
   04740 Olfactory transduction
    403556 (PRKACA)
   04742 Taste transduction
    403556 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    403556 (PRKACA)
  Aging
   04211 Longevity regulating pathway - mammal
    403556 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    403556 (PRKACA)
  Environmental adaptation
   04713 Circadian entrainment
    403556 (PRKACA)
   04714 Thermogenesis
    403556 (PRKACA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    403556 (PRKACA)
   05205 Proteoglycans in cancer
    403556 (PRKACA)
   05203 Viral carcinogenesis
    403556 (PRKACA)
  Neurodegenerative diseases
   05012 Parkinson's disease
    403556 (PRKACA)
   05020 Prion diseases
    403556 (PRKACA)
  Substance dependence
   05030 Cocaine addiction
    403556 (PRKACA)
   05031 Amphetamine addiction
    403556 (PRKACA)
   05032 Morphine addiction
    403556 (PRKACA)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    403556 (PRKACA)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    403556 (PRKACA)
  Infectious diseases
   05166 HTLV-I infection
    403556 (PRKACA)
   05169 Epstein-Barr virus infection
    403556 (PRKACA)
   05165 Human papillomavirus infection
    403556 (PRKACA)
   05146 Amoebiasis
    403556 (PRKACA)
  Drug resistance
   01522 Endocrine resistance
    403556 (PRKACA)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     403556 (PRKACA)
Protein kinases [BR:cfa01001]
 Serine/threonine kinases: AGC group
  PKA family
   403556 (PRKACA)
Messenger RNA biogenesis [BR:cfa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     403556 (PRKACA)
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    403556 (PRKACA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 403556
NCBI-ProteinID: NP_001003032
Ensembl: ENSCAFG00000016488
UniProt: Q8MJ44
Position
20
AA seq 350 aa AA seqDB search
MGNAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLV
KHKETGNHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVM
EYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYI
QVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFA
DQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATT
DWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFCEF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgccgccgccaagaagggcagcgagcaggagagcgtgaaagagttcttagcc
aaagccaaagaagactttcttaaaaaatgggaaaatcctgctcagaatacagcccatttg
gatcagtttgaacgaatcaagaccctcggcacgggctcctttgggcgggtgatgctggtg
aagcacaaggagaccgggaaccactttgccatgaagatcctcgacaaacagaaggtcgtg
aagctgaaacagattgagcataccctgaacgaaaagcgcatcctgcaagcggtcaacttc
ccgttcctcgtcaaactcgagttctccttcaaggacaactcgaatttatacatggtcatg
gagtatgtgcctggcggggagatgttctcgcacctgcggcggatcggaaggttcagtgaa
ccgcatgcccgcttctatgcggcccagatcgtcctgaccttcgagtacctgcactcactt
gacctcatctaccgggacctgaagccggagaacctcctcattgaccagcagggctacatt
caggtgacagacttcggttttgccaagcgtgtaaaaggccgcacctggaccttatgcggg
acccccgagtacctggccccggaaatcatcctgagcaaaggctacaacaaggctgtggac
tggtgggccctaggggttctcatctacgagatggccgctggctacccacccttctttgct
gaccagcccatccagatctatgagaagattgtctctgggaaggtgcggttcccgtcccac
ttcagctctgacctgaaggatctgctacggaacctgttgcaggtggacctcaccaaacgc
ttcgggaacctcaagaatggggtgaacgatatcaagaaccacaagtggtttgccacaact
gactggatcgccatctatcagaggaaggtggaagctcccttcataccaaagtttaaaggc
cctggggacacgagtaattttgacgactatgaggaggaagagatccgagtctccatcaat
gagaagtgtggcaaggagttttgtgagttctag

DBGET integrated database retrieval system