KEGG   Canis familiaris (dog): 403557Help
Entry
403557            CDS       T01007                                 

Gene name
PPP1CC
Definition
protein phosphatase 1, catalytic subunit, gamma isozyme (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
cfa  Canis familiaris (dog)
Pathway
mRNA surveillance pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Hippo signaling pathway
Focal adhesion
Platelet activation
Long-term potentiation
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
Regulation of actin cytoskeleton
Insulin signaling pathway
Oxytocin signaling pathway
Amphetamine addiction
Alcoholism
Herpes simplex infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    403557 (PPP1CC)
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    403557 (PPP1CC)
   04024 cAMP signaling pathway
    403557 (PPP1CC)
   04022 cGMP - PKG signaling pathway
    403557 (PPP1CC)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    403557 (PPP1CC)
  Cell growth and death
   04114 Oocyte meiosis
    403557 (PPP1CC)
  Cellular commiunity
   04510 Focal adhesion
    403557 (PPP1CC)
 Organismal Systems
  Immune system
   04611 Platelet activation
    403557 (PPP1CC)
  Endocrine system
   04910 Insulin signaling pathway
    403557 (PPP1CC)
   04921 Oxytocin signaling pathway
    403557 (PPP1CC)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    403557 (PPP1CC)
   04270 Vascular smooth muscle contraction
    403557 (PPP1CC)
  Nervous system
   04728 Dopaminergic synapse
    403557 (PPP1CC)
   04720 Long-term potentiation
    403557 (PPP1CC)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    403557 (PPP1CC)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    403557 (PPP1CC)
  Substance dependence
   05031 Amphetamine addiction
    403557 (PPP1CC)
   05034 Alcoholism
    403557 (PPP1CC)
  Infectious diseases
   05168 Herpes simplex infection
    403557 (PPP1CC)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     403557 (PPP1CC)
Protein phosphatases and associated proteins [BR:cfa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     403557 (PPP1CC)
Transcription machinery [BR:cfa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     403557 (PPP1CC)
Spliceosome [BR:cfa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    403557 (PPP1CC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
26
AA seq 323 aa AA seqDB search
MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECVSINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGETDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNATRPVTPLRGMITKQAKK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcggatatcgataaactcaacatcgacagcatcatccaacggctgctggaagtgaga
gggtccaagcctggtaagaatgtccagctacaggaaaatgaaatccgaggactgtgctta
aagtcccgagagatctttctcagtcagcctatcctactagaacttgaagcaccactcaaa
atatgtggtgatatccatgggcaatactatgatttgcttcgacttttcgagtacggtggt
ttcccgccagaaagcaactacctgtttcttggggactatgtggacagggggaagcagtca
ttggagactatctgcctcttactggcttacaaaatcaaatatcccgagaatttttttctt
ctcagaggaaaccatgaatgtgtcagcatcaatagaatttatggattttacgatgaatgt
aaaagaagatataacattaaactatggaaaactttcacagactgctttaactgtttaccg
atagcagccatcgtggatgagaagatattctgctgtcatggaggtttatcaccagatctt
caatctatggagcagattcggcgaattatgcgaccaactgatgtaccagatcaaggtctt
ctttgtgatcttttgtggtctgaccccgataaagatgtcttaggctggggtgaaactgac
agaggagtgtccttcacatttggtgcagaagtggttgcaaaatttctccataagcatgat
ttggatcttatatgtagagcccatcaggtggttgaagatggatatgaattttttgcaaag
aggcagttggtcactctgttttctgcacccaattattgtggagagtttgacaatgcaggt
gccatgatgagtgtggacgaaactctaatgtgttcttttcagattttaaagcctgcagag
aaaaagaagccgaatgccacgagacctgtaacacctctaaggggtatgatcacaaagcaa
gcaaagaaatag

DBGET integrated database retrieval system