KEGG   Canis familiaris (dog): 403609Help
Entry
403609            CDS       T01007                                 

Gene name
PPP1CA
Definition
(RefSeq) protein phosphatase 1 catalytic subunit alpha
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa03015  mRNA surveillance pathway
cfa04022  cGMP-PKG signaling pathway
cfa04024  cAMP signaling pathway
cfa04114  Oocyte meiosis
cfa04218  Cellular senescence
cfa04261  Adrenergic signaling in cardiomyocytes
cfa04270  Vascular smooth muscle contraction
cfa04390  Hippo signaling pathway
cfa04510  Focal adhesion
cfa04611  Platelet activation
cfa04720  Long-term potentiation
cfa04728  Dopaminergic synapse
cfa04750  Inflammatory mediator regulation of TRP channels
cfa04810  Regulation of actin cytoskeleton
cfa04910  Insulin signaling pathway
cfa04921  Oxytocin signaling pathway
cfa04931  Insulin resistance
cfa05031  Amphetamine addiction
cfa05034  Alcoholism
cfa05168  Herpes simplex infection
cfa05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    403609 (PPP1CA)
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    403609 (PPP1CA)
   04024 cAMP signaling pathway
    403609 (PPP1CA)
   04022 cGMP - PKG signaling pathway
    403609 (PPP1CA)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    403609 (PPP1CA)
   04218 Cellular senescence
    403609 (PPP1CA)
  Cellular community - eukaryotes
   04510 Focal adhesion
    403609 (PPP1CA)
  Cell motility
   04810 Regulation of actin cytoskeleton
    403609 (PPP1CA)
 Organismal Systems
  Immune system
   04611 Platelet activation
    403609 (PPP1CA)
  Endocrine system
   04910 Insulin signaling pathway
    403609 (PPP1CA)
   04921 Oxytocin signaling pathway
    403609 (PPP1CA)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    403609 (PPP1CA)
   04270 Vascular smooth muscle contraction
    403609 (PPP1CA)
  Nervous system
   04728 Dopaminergic synapse
    403609 (PPP1CA)
   04720 Long-term potentiation
    403609 (PPP1CA)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    403609 (PPP1CA)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    403609 (PPP1CA)
  Substance dependence
   05031 Amphetamine addiction
    403609 (PPP1CA)
   05034 Alcoholism
    403609 (PPP1CA)
  Endocrine and metabolic diseases
   04931 Insulin resistance
    403609 (PPP1CA)
  Infectious diseases
   05168 Herpes simplex infection
    403609 (PPP1CA)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     403609 (PPP1CA)
Protein phosphatases and associated proteins [BR:cfa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     403609 (PPP1CA)
Transcription machinery [BR:cfa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     403609 (PPP1CA)
Messenger RNA biogenesis [BR:cfa03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     403609 (PPP1CA)
Spliceosome [BR:cfa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    403609 (PPP1CA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos STPPase_N
Motif
Other DBs
NCBI-GeneID: 403609
NCBI-ProteinID: NP_001003064
Ensembl: ENSCAFG00000011565
UniProt: L7N0D0
Position
18
AA seq 330 aa AA seqDB search
MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KNKGKYGQFSGLNPGGRPITPPRNSAKAKK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacagtgagaagctcaacctggactccatcatcgggcgcctgctggaagtgcag
ggctcgcggcctggaaagaatgtacagctaacagagaacgagatccgtggtctgtgcctc
aaatcacgggagattttcctgagccagcccattcttttggagctggaggcacccctcaag
atctgcggtgacatccatggccagtactacgaccttctgcggctcttcgagtatggtggc
ttccctccagagagcaactacctcttcctgggggactacgtggaccggggcaagcagtct
ttggaaaccatctgcttgctgctggcctataagatcaagtaccccgaaaacttcttcctg
ctccgtgggaaccatgagtgtgctagcatcaaccgcatctatggcttctacgatgagtgc
aagagacgctacaatattaaactgtggaagacctttactgactgcttcaactgcctgccc
attgctgccatcgtggatgagaagatcttctgctgccatggaggcctgtccccagacctg
cagtccatggagcagattcggcgtatcatgcggcctacagacgtgccggaccagggcctg
ctgtgcgacctgctgtggtctgaccctgacaaggacgtgcagggctggggcgagaatgac
cgtggtgtctcctttacctttggggctgaggtagtggccaaattcctgcacaagcacgac
ttggacctcatctgccgggcacaccaggtggtagaagatggctatgaattctttgccaag
cggcagctggtgactctcttctcggctcccaactactgtggcgagtttgacaatgcaggc
gccatgatgagtgtggatgagacactcatgtgctccttccagatactcaagcccgctgac
aagaacaaggggaaatacgggcaattcagtggcttgaaccctggaggccggcccatcacc
ccaccccgcaactccgccaaagccaagaaatag

DBGET integrated database retrieval system