KEGG   Canis familiaris (dog): 403609Help
Entry
403609            CDS       T01007                                 

Gene name
PPP1CA
Definition
protein phosphatase 1, catalytic subunit, alpha isozyme (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
cfa  Canis familiaris (dog)
Pathway
mRNA surveillance pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Hippo signaling pathway
Focal adhesion
Platelet activation
Long-term potentiation
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
Regulation of actin cytoskeleton
Insulin signaling pathway
Oxytocin signaling pathway
Amphetamine addiction
Alcoholism
Herpes simplex infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    403609 (PPP1CA)
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    403609 (PPP1CA)
   04024 cAMP signaling pathway
    403609 (PPP1CA)
   04022 cGMP - PKG signaling pathway
    403609 (PPP1CA)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    403609 (PPP1CA)
  Cell growth and death
   04114 Oocyte meiosis
    403609 (PPP1CA)
  Cellular commiunity
   04510 Focal adhesion
    403609 (PPP1CA)
 Organismal Systems
  Immune system
   04611 Platelet activation
    403609 (PPP1CA)
  Endocrine system
   04910 Insulin signaling pathway
    403609 (PPP1CA)
   04921 Oxytocin signaling pathway
    403609 (PPP1CA)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    403609 (PPP1CA)
   04270 Vascular smooth muscle contraction
    403609 (PPP1CA)
  Nervous system
   04728 Dopaminergic synapse
    403609 (PPP1CA)
   04720 Long-term potentiation
    403609 (PPP1CA)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    403609 (PPP1CA)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    403609 (PPP1CA)
  Substance dependence
   05031 Amphetamine addiction
    403609 (PPP1CA)
   05034 Alcoholism
    403609 (PPP1CA)
  Infectious diseases
   05168 Herpes simplex infection
    403609 (PPP1CA)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     403609 (PPP1CA)
Protein phosphatases and associated proteins [BR:cfa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     403609 (PPP1CA)
Transcription machinery [BR:cfa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     403609 (PPP1CA)
Spliceosome [BR:cfa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    403609 (PPP1CA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
18
AA seq 330 aa AA seqDB search
MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDXFNXLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KNKGKYGQFSGLNPGGRPITPPRNSAKAKK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacagcgagaagctcaacctggactccatcatcgggcgcctgctggaagtgcag
ggctcgcggcctggaaagaatgtacagctaacagagaacgagatccgtggtctgtgcctc
aaatcacgggagattttcctgagccagcccattcttttggagctggaggcacccctcaag
atctgcggtgacatccatggccagtactacgaccttctgcggctcttcgagtatggtggc
ttccctccagagagcaactacctcttcctgggggactacgtggaccggggcaagcagtct
ttggaaaccatctgcttgctgctggcctataagatcaagtaccccgaaaacttcttcctg
ctccgtgggaaccatgagtgtgctagcatcaaccgcatctatggcttctacgatgagtgc
aagagacgctacaatattaaactgtggaagacctttactgactgnttcaactgnctgccc
attgctgccatcgtggatgagaaaatcttctgctgccatggaggcctgtccccagacctg
cagtccatggagcagattcggcgtatcatgcggcctacagacgtgccggaccagggcctg
ctgtgcgacctgctgtggtctgaccctgacaaggacgtgcagggctggggcgagaatgac
cgtggtgtctcctttacctttggggctgaggtagtggccaaattcctgcacaagcacgac
ttggacctcatctgccgggcacaccaggtggtagaagatggctatgaattctttgccaag
cggcagctggtgactctcttctcggctcccaactactgtggcgagtttgacaatgcaggc
gccatgatgagtgtggatgagacactcatgtgctccttccagatactcaagcccgctgac
aagaacaaggggaaatacgggcaattcagtggcttgaaccctggaggccggcccatcacc
ccaccccgcaactccgccaaagccaagaaatag

DBGET integrated database retrieval system