KEGG   Canis familiaris (dog): 403618Help
Entry
403618            CDS       T01007                                 

Gene name
BCL2L1, BCL-XL
Definition
(RefSeq) BCL2 like 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
cfa  Canis familiaris (dog)
Pathway
cfa01521  EGFR tyrosine kinase inhibitor resistance
cfa01524  Platinum drug resistance
cfa04014  Ras signaling pathway
cfa04064  NF-kappa B signaling pathway
cfa04137  Mitophagy - animal
cfa04140  Autophagy - animal
cfa04151  PI3K-Akt signaling pathway
cfa04210  Apoptosis
cfa04215  Apoptosis - multiple species
cfa04621  NOD-like receptor signaling pathway
cfa04630  Jak-STAT signaling pathway
cfa05014  Amyotrophic lateral sclerosis (ALS)
cfa05145  Toxoplasmosis
cfa05166  HTLV-I infection
cfa05200  Pathways in cancer
cfa05202  Transcriptional misregulation in cancer
cfa05212  Pancreatic cancer
cfa05220  Chronic myeloid leukemia
cfa05222  Small cell lung cancer
cfa05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    403618 (BCL2L1)
   04630 Jak-STAT signaling pathway
    403618 (BCL2L1)
   04064 NF-kappa B signaling pathway
    403618 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    403618 (BCL2L1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    403618 (BCL2L1)
   04137 Mitophagy - animal
    403618 (BCL2L1)
  Cell growth and death
   04210 Apoptosis
    403618 (BCL2L1)
   04215 Apoptosis - multiple species
    403618 (BCL2L1)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    403618 (BCL2L1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    403618 (BCL2L1)
   05202 Transcriptional misregulation in cancers
    403618 (BCL2L1)
   05212 Pancreatic cancer
    403618 (BCL2L1)
   05225 Hepatocellular carcinoma
    403618 (BCL2L1)
   05220 Chronic myeloid leukemia
    403618 (BCL2L1)
   05222 Small cell lung cancer
    403618 (BCL2L1)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    403618 (BCL2L1)
  Infectious diseases
   05166 HTLV-I infection
    403618 (BCL2L1)
   05145 Toxoplasmosis
    403618 (BCL2L1)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    403618 (BCL2L1)
   01524 Platinum drug resistance
    403618 (BCL2L1)
Protein phosphatases and associated proteins [BR:cfa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     403618 (BCL2L1)
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    403618 (BCL2L1)
Transporters [BR:cfa02000]
 Other Transporters
  Pores ion channels [TC:1]
   403618 (BCL2L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2 BH4 Bcl-2_3 Nitrate_red_del
Motif
Other DBs
NCBI-GeneID: 403618
NCBI-ProteinID: NP_001003072
Ensembl: ENSCAFG00000007053
UniProt: Q76LT7
Position
24
AA seq 233 aa AA seqDB search
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaaggg
actgaatcagagatggagacccccagtgccatcaatggcaacccatcctggcacttggca
gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg
atccccatggcagcggtgaaacaagcgctgagggaggctggggatgagtttgaactgagg
taccggcgggcattcagtgacctgacatcccagcttcacatcaccccagggacagcatat
cagagctttgagcaggtagtgaatgaactcttccgggatggggtgaactggggtcgcatt
gtggcctttttctccttcggtggggcactgtgcgtggagagcgtagacaaggagatgcag
gtattggtgagtcggatcgcagcttggatggccacttacctgaatgaccacctagagcct
tggatccaggagaacggcggctgggatacttttgtggaactctacgggaacaatgcagca
gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacaggcatgactgtg
gctggtgtggttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system