KEGG   Canis familiaris (dog): 403626Help
Entry
403626            CDS       T01007                                 

Gene name
LPL
Definition
lipoprotein lipase
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
cfa  Canis familiaris (dog)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    403626 (LPL)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    403626 (LPL)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    403626 (LPL)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     403626 (LPL)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   403626 (LPL)
  Exosomal proteins of breast milk
   403626 (LPL)
Heparan sulfate/heparin binding proteins [BR:cfa00536]
 Enzymes (General comment) Variety
  403626 (LPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
25
AA seq 472 aa AA seqDB search
MESRALLLVALGMWLQSLAAAARIPGGNDFVDIESKFALRTPEDTAEDTCHLIPGVIESV
ANCHFNHTSKTFVVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQQHYPVS
AGYTKLVGKDVAKFINWLAEEFQYPLDNVHLLGYSLGAHAAGIAGSLTNKKVNRITGLDP
AGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQPGCN
IGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCNSKEAFEKGLCLS
CRKNRCNNMGYEINKVRAKRGSKMYLKTRSQMPYKVFHYQVKIHFSGTESDAQTNQAFEI
SLYGTVAESENIPFTLPEVSANKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDWWSSP
GFAIEKIRVKAGETQKKVIFCSREKVSHLQKGKSSVVFVKCHDKSLNKKSGW
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggagagcagagccctactcctggtggccctgggcatgtggctgcagagtctggccgcc
gccgcccgaattccaggaggaaatgattttgtagatatcgaaagtaaatttgctctaagg
acccctgaagacacagctgaggatacctgccacctcattcccggagtgatagaatctgtg
gctaactgccacttcaatcacaccagcaagacctttgtggtgatccatggctggacggtg
acaggaatgtatgagagttgggtgccaaaacttgtggctgccctgtacaagagggaaccg
gactccaatgtcattgtggtggactggctgtcacgagcccagcagcattatccagtgtct
gcagggtacaccaagctggtgggaaaagatgtggccaagttcatcaactggttggcggag
gaatttcagtatcctctggacaatgtccatcttttgggatacagccttggagcgcatgct
gctggcattgcaggaagtctgaccaataagaaggtcaatagaattactggtctagatcca
gctggacctaactttgagtatgcagaagctccaagtcgtctttctcctgatgatgcagat
tttgtagatgtcttacacacattcacaagagggtcacctggccgaagtattggaatccag
aaaccagtaggacatgttgatatttatcctaatggaggcacttttcaaccaggatgtaac
attggggaagccatccgtgtgattgcagagagaggccttggagatgtggaccagctagtg
aaatgctcccatgagcggtccattcacctctttattgactctctgctgaatgaagaaaat
ccaagtaaggcctaccggtgcaactcaaaggaagcctttgagaaagggctttgcctgagt
tgcagaaagaaccgttgcaacaacatgggctatgagatcaataaggtcagagccaaaaga
ggcagcaaaatgtacctgaagactcgctctcagatgccttacaaagtcttccattaccaa
gtaaagatacatttttctgggactgagagtgatgcacagaccaaccaggccttcgagatc
tctctgtatggcactgtggctgagagtgagaacatcccttttaccctgcctgaagtttct
gctaataagacatactcttttctaatttacacggaggtggatattggagaactgctaatg
ttgaaactcaaatggaagagtgattcatacttcagctggtcagactggtggagcagccct
ggctttgctattgagaagatcagagtaaaagctggagagactcagaaaaaggtaatcttc
tgttccagggagaaagtgtctcatctgcagaaaggaaagtcgtctgtggtatttgtgaaa
tgccatgacaagtctctgaataagaagtctggctggtga

DBGET integrated database retrieval system