KEGG   Canis familiaris (dog): 403629Help
Entry
403629            CDS       T01007                                 

Gene name
UGT1A6
Definition
UDP glucuronosyltransferase 1 family, polypeptide A6 (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
cfa  Canis familiaris (dog)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    403629 (UGT1A6)
   00053 Ascorbate and aldarate metabolism
    403629 (UGT1A6)
   00500 Starch and sucrose metabolism
    403629 (UGT1A6)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    403629 (UGT1A6)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    403629 (UGT1A6)
   00860 Porphyrin and chlorophyll metabolism
    403629 (UGT1A6)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    403629 (UGT1A6)
   00982 Drug metabolism - cytochrome P450
    403629 (UGT1A6)
   00983 Drug metabolism - other enzymes
    403629 (UGT1A6)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    403629 (UGT1A6)
Enzymes [BR:cfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     403629 (UGT1A6)
Glycosyltransferases [BR:cfa01003]
 Others
  Hydrophobic molecule
   403629 (UGT1A6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
25
AA seq 528 aa AA seqDB search
MARLLHLFQKVFFLMLWGEAVGDKLLVVPQDGSHWLSMENIVELLSEKGHDIVVLVPEVN
LLLKESKHYTRQIYSVPFGQEGLENRYRSFGKNHFAERWLLNAAQMEYRNSMIVIDMYFT
NCQSLLEDSATLSVLRQSKFDALFTDPALPCGVILAEYLGLPSVYLFRGFPCSLEHTISR
SPNPVSYIPRCYTQFSDKMTFPQRVGSYLVNYLETYLFYCLYSKYEDLASNILMRDVHLP
TLYRNGSIWLLRYDFVFEYPRPVMPNMVFIGGTNCKMKGVLPQEFEAYVNASGEHGIVVF
SLGSMVSDIPEKKAMEIADALGKIPQTVLWRYTGTPPPNLSKNTILVKWLPRNDLLGHPK
ARAFITHSGSHGIYEGICNGVPMVMLPLFGDQMDNAKRMETRGAGVTLNVLEMTSGDLAN
ALKAVINDKSYKENIMHLSRLHKDRPIEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQ
YHSLDVIGFLLAVVLGVVFITYKCCAFGCRKCFGKKGRVKKPHKSKAH
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcctccttcatttgtttcaaaaggtgttcttcctaatgctctggggggaggct
gtaggtgacaagcttctggtggtccctcaggacggaagccactggctcagtatggagaac
atagttgagctcctcagtgagaaggggcatgacattgtggtgctggtgccagaagtcaat
ttgcttctgaaggaatccaaacactacacgagacaaatctactcagtgccatttggccag
gaagggttggagaaccgctaccgctcttttggaaagaatcactttgctgagagatggctc
ctgaacgctgctcagatggagtacagaaatagcatgattgttattgacatgtacttcacc
aactgccagagccttctggaggactcggccacgctcagtgtcctcaggcagagcaagttc
gatgcccttttcacagacccagctctgccctgtggggtgatcctggccgagtacctgggc
ctgccctccgtgtacctcttcaggggcttcccatgctccctggagcatactatcagcagg
agcccaaaccctgtgtcctacattcccaggtgctatactcagttctcagacaagatgaca
tttccccaacgggtgggcagctacctcgttaattacctggagacctacctgttctactgt
ctgtattcaaagtacgaagaccttgcatccaatatcctcatgagagatgtgcacttaccc
accttgtatcggaacggctccatttggctgttacgatatgactttgtgtttgagtatccc
agaccagtcatgcccaacatggttttcattggagggaccaactgcaagatgaagggagtc
ctgcctcaggaatttgaagcctatgttaatgcttctggagaacatggaattgtggttttc
tctttgggctccatggtatcagatattcctgagaagaaagctatggagattgctgatgct
ttgggcaaaatacctcagacggtcctgtggcgttatactggcactccaccaccgaatctt
tcaaagaatacaatacttgtcaagtggctgccccggaatgatctgcttggtcacccgaag
gctcgcgcctttatcacacattctggctcccatggcatatatgagggaatatgcaacggc
gttccaatggtgatgctgcccttgtttggtgatcagatggacaatgcgaagcgcatggag
actcggggggctggagtgaccttgaatgtcctggaaatgacttctggagatttagcaaat
gccctaaaagctgtcatcaatgacaaaagctataaggagaacatcatgcacctctccagg
ctgcacaaggaccgccccatcgagcccctggacctggctgtgttctgggtggagttcgtc
atgaggcacaagggggctccccacctgcgtcccgcagcccacgacctcacctggtaccag
taccactctttggacgtgatcggcttcctcctggccgtggtgctgggggttgtcttcatc
acttacaaatgttgtgcctttggctgccggaagtgctttgggaaaaaaggacgggttaag
aaacctcacaaatccaaggcacactga

DBGET integrated database retrieval system