KEGG   Canis familiaris (dog): 403849Help
Entry
403849            CDS       T01007                                 

Gene name
PFKM, ATP-PFK, M-PFK, PFK-M
Definition
phosphofructokinase, muscle (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cfa  Canis familiaris (dog)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
AMPK signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    403849 (PFKM)
   01230 Biosynthesis of amino acids
    403849 (PFKM)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    403849 (PFKM)
   00030 Pentose phosphate pathway
    403849 (PFKM)
   00051 Fructose and mannose metabolism
    403849 (PFKM)
   00052 Galactose metabolism
    403849 (PFKM)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    403849 (PFKM)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    403849 (PFKM)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    403849 (PFKM)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     403849 (PFKM)
Protein phosphatases and associated proteins [BR:cfa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     403849 (PFKM)
Messenger RNA biogenesis [BR:cfa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     403849 (PFKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
27
AA seq 782 aa AA seqDB search
MTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVD
GGDHIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAHNLVKRGITNLCVIGGDG
SLTGADTFRSEWSDLLSDLQKAGKITAEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDS
ALHRIIEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWE
EHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPITSEEIKELVVKRLGYDTRVTVLGHVQ
RGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTK
AMNDRKFDEAMKLRGRSFMNNWEVYKLLAHIRPPVSKTSATMHTVAVMNVGAPAAGMNAA
VRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSF
EQISANITKFNIQGLIIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATVSNNVPGSDF
SVGADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEE
PFTIRDLQANVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNV
LGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRAL
VFQPVTELKDQTDFDHRIPKEQWWLKLRPILKILAKYEIDLDTTEHAHLEHISRKRSGET
SI
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgacccatgaagagcaccatgcagccaaaaccctggggatcggcaaagccatcgccgtg
ttaacctctggtggagatgcccaaggtatgaatgctgctgtcagggctgtggttcgagtg
ggtatctttactggtgcccgtgtcttctttgtccatgagggttaccaaggcctggtggat
ggtggagatcacatcagggaagccacctgggagagcgtttcgatgatgcttcagctgggt
ggcacagtcattggaagtgcccggtgtaaggattttcgggaacgagaggggcgacttcga
gctgcccacaacctagtgaaacgtgggatcaccaatctgtgtgtcatcgggggtgatggc
agcctcactggggcggacaccttccgttctgagtggagtgacttgctgagtgacctccag
aaagcgggtaagatcacagcggaggaggctacgaagtccagctacctgaatatcgtgggc
ttggtgggctcaattgacaatgacttttgcggcactgacatgaccatcggcaccgactct
gccctgcaccggatcatagagatcgtggatgccatcaccactactgctcagagccaccag
aggacgtttgtgttggaagtgatgggccggcactgtggatacctggcccttgtcacctcc
ctctcctgtggggctgactgggtttttattcctgaatgtccgccagatgatgactgggag
gaacatctttgtcgccggcttagtgagacaaggacccggggttctcgtctcaacatcatc
attgtggctgagggtgcgattgacaagaatgggaaaccaatcacctcagaagaaatcaag
gagctggtggtaaagcgtctgggatatgacactcgggtcactgtcttggggcatgtgcag
cggggtgggaccccatcagccttcgaccgaatcctgggcagcaggatgggtgtggaagca
gtgatggcgctcttggaggggaccccggacaccccggcctgcgtggtgagcctctctggt
aaccaggctgtgcgcctgcccctcatggagtgtgtacaggtgaccaaggatgtgaccaag
gccatgaatgacaggaaattcgatgaagccatgaagctgagaggccggagcttcatgaac
aactgggaggtgtacaagcttctggctcacatcagacctcccgtctcgaagacatcggct
accatgcacacggtggccgtgatgaacgtgggtgccccagccgcaggcatgaatgctgcc
gtccgctccaccgtgagaattggactcatccagggcaaccgggtgctggttgtgcatgat
ggcttcgagggcctggccaagggtcagatcgaggaggctggctggagctatgtggggggc
tggactggccaaggcggttccaaacttgggactaagaggactctgcccaagaagagcttt
gagcagatcagtgccaacatcactaagtttaacattcagggcctgatcatcatcgggggc
tttgaggcttacactgggggcctggagctgatggagggcaggaagcagtttgatgagctg
tgcatcccgtttgtggtcatccctgctacggtgtccaacaacgtccctggctcggacttc
agcgtgggcgctgacacagccctcaacactatctgcacgacctgtgaccgcatcaagcag
tcagcagcaggcaccaagcggcgggtgttcatcattgaaactatgggtggctactgcggc
tacctggccaccatggcaggcctggccgctggggcggatgctgcctacatttttgaggag
cccttcaccattcgggacctgcaggcaaatgttgaacatctggtgcaaaagatgaaaaca
actgtgaagaggggcctggtgttaaggaatgagaagtgcaatgagaactataccacggac
ttcattttcaacctgtactctgaggaggggaagggcatcttcgacagcaggaagaatgtg
ctcggccacatgcagcagggtgggagcccaactccatttgataggaattttgccactaag
atgggcgccaaggctatgaactggatgtctgggaaaatcaaagagagttaccgtaatggg
aggatctttgccaatacgccagactcgggctgtgttctggggatgcgtaagagggctctg
gtctttcaaccagtgactgagctgaaggaccagacagattttgatcaccgcatccccaag
gaacagtggtggctgaagctgaggcccatcctcaaaatcctagccaagtacgagattgac
ttggacaccacagagcacgcccacctggagcacatcagtcggaagcgatctggagaaact
tctatctaa

DBGET integrated database retrieval system