KEGG   Canis familiaris (dog): 403873Help
Entry
403873            CDS       T01007                                 

Gene name
GLB1
Definition
galactosidase, beta 1 (EC:3.2.1.23)
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
cfa  Canis familiaris (dog)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Module
Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    403873 (GLB1)
  Lipid metabolism
   00600 Sphingolipid metabolism
    403873 (GLB1)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    403873 (GLB1)
   00604 Glycosphingolipid biosynthesis - ganglio series
    403873 (GLB1)
   00511 Other glycan degradation
    403873 (GLB1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    403873 (GLB1)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     403873 (GLB1)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   403873 (GLB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
23
AA seq 668 aa AA seqDB search
MARPAAVRVLWALLLPLLLGSARGLRNASQRTFTIDYSHNRFLKDGQPFRYISGSIHYSR
VPRFYWKDRLLKMKMAGLNAIQTYVPWNFHEPQPGQYQFSGEQDVEYFIKLAHELGLLVI
LRPGPYICAEWDMGGLPAWLLLKESIILRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGP
IITMQVENEYGSYFTCDYDYLRFLQKLFHHHLGNDVLLFTTDGANEKFLQCGALQGLYAT
VDFGPGANITAAFQIQRKSEPKGPLVNSEFYTGWLDHWGQPHSTVRTEVVASSLHDILAH
GANVNLYMFIGGTNFAYWNGANMPYQAQPTSYDYDAPLSEAGDLTEKYFALREVIRKFEK
VPEGFIPPSTPKFAYGKVALKKLKTVEEALNVLCPPGPINSLYPLTFIQVKQYFGFVMYR
TTLPQDCSDPTPLSSPLSGVHDRAYVSVDGVPQGVMERSNVITLNITGKAGATLDLLVEN
MGRVNYGRYINDFKGLISNLTLGSSILTNWMIFPLNTEDAVRSHLGGWHGPNNGRHDKTF
AHRSSNYTLPAFYMGNFSIPSGIPDLPQDTFIQFPGWTKGQVWINGFNLGRYWPARGPQM
TLFVPRHILVTSTPNTIMVLELEHAPCGDSGPEVCTVEFVDRPVIGAPPTPGHPPPDLSH
RDLRLDYV
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggcccgcggcggttcgcgtgctctgggcgctgctgctgccgctgctgctgggc
tctgcgcgcggcctgcggaatgcttcccagaggacattcacaattgactacagccacaac
cgcttcctgaaggacggccagcccttccgctacatttcgggaagcattcactattcccgc
gtgccccgcttctactggaaggaccggctgctgaagatgaagatggctgggctgaatgcc
atccagacgtacgtgccctggaactttcacgaaccccagccgggacagtaccagttttct
ggggagcaggatgtggaatattttattaagctggcccatgagctgggactgctggtcatc
ctgaggccgggaccctatatctgtgcagagtgggacatgggaggattacctgcttggcta
ttattaaaagaatctattattctccgttcttctgatccagattaccttgcagctgtggac
aaatggttgggagtcctcctgcccaagatgaagcctctcctctatcagaacggagggccg
attataaccatgcaggttgaaaatgaatatggcagctactttacctgcgattatgactac
ctgcgtttcctgcagaagctcttccaccaccacctgggcaatgatgtacttctgttcacc
actgatggggcaaatgaaaagtttctgcagtgcggggctctgcagggcctctatgccaca
gtggactttggaccaggtgccaacatcactgctgctttccaaatccagagaaagagtgag
cccaaaggaccattggtgaattctgaattctataccggctggttggatcattggggccag
ccacactcaacagtgaggactgaagtggtggcttcctccctccatgatatacttgcccat
ggggcaaatgtgaacttgtacatgttcataggtgggaccaattttgcctattggaatggg
gccaacatgccctaccaagcacagcccaccagttacgactatgatgccccactgagcgag
gcaggggacctcactgagaagtattttgctctgcgagaagttattcggaagtttgaaaaa
gtaccagaaggttttatccctccgtctacacccaagtttgcatatggaaaagttgctctg
aagaagttaaagacggtggaggaggccctgaatgttctgtgtccgcctgggcccataaac
agcctttatcccttgacgtttatccaggtgaaacagtatttcggttttgtgatgtaccga
acaacacttcctcaagactgcagtgaccccacacccctgtcttcacccctcagtggagtc
cacgaccgcgcctatgtctctgtggatggggtgccccagggagtcatggagcgaagtaat
gtcatcactctgaacataaccgggaaggctggagccactctggacctgctggtggagaac
atgggacgtgtgaactatggcagatatatcaatgattttaagggccttatttctaacctg
acccttgggtccagtatcctcacaaactggatgatcttcccgttgaacactgaggatgca
gtacgcagccacctgggaggctggcatggccctaacaatggccgccatgataaaaccttt
gcccaccgctcgtctaactacacgctcccggccttttatatggggaacttctctattccc
agtgggatcccagacttgccccaggacacctttatccagtttcctggatggaccaagggt
caggtgtggattaatggctttaacctcggtcgatattggccagcacggggcccccagatg
actttgtttgtgccacggcacatcctggtgacatcaaccccaaacaccatcatggtgctg
gaactggagcacgcgccctgtggtgacagtggcccagaagtgtgcaccgtggagtttgtg
gacaggccggttatcggtgcccctccaacccctggtcatccccctccagacctgtcccat
cgagacttgagactggactatgtctga

DBGET integrated database retrieval system