KEGG   Canis familiaris (dog): 403983Help
Entry
403983            CDS       T01007                                 

Gene name
KCNMB1
Definition
potassium large conductance calcium-activated channel, subfamily M, beta member 1
Orthology
K04937  
potassium large conductance calcium-activated channel subfamily M beta member 1
Organism
cfa  Canis familiaris (dog)
Pathway
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Insulin secretion
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    403983 (KCNMB1)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    403983 (KCNMB1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    403983 (KCNMB1)
Ion channels [BR:cfa04040]
 Voltage-gated cation channels
  K+ channel, KCNM, KCa1.x
   403983 (KCNMB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 191 aa AA seqDB search
MGKKLVMAQKRGETRALCLGVAMVMCAVIAYYILGTTMLPLYQKSVWTQKSTCHLIETNI
REQEELEGKKVPQYPCLWVNVSAVGRWAVLYHTEDTRDQNHQCSYIPGSLENYQVARADV
EKVKAKFHEQQIFYCFSTTRENETTVLYRRLYGPQTLLFSLFWPTFLLTGGLLIIAMVKI
NQSLSILAAQR
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagaagctggtgatggcccaaaagcggggagagactcgagccctttgcctgggt
gtggccatggtgatgtgtgctgtcattgcctactatatcctgggcacgaccatgctgccc
ctctaccagaaaagtgtgtggacgcagaaatccacgtgccatctgattgagaccaacatc
agggagcaggaggagctggagggcaagaaggtgccccagtacccgtgcctgtgggtcaac
gtgtcagctgtgggccggtgggctgtgctgtaccacacagaggacactcgggaccagaac
caccagtgctcctatatcccaggcagcctggagaactaccaagttgcccgggccgatgtg
gagaaggtcaaagccaaattccacgagcaacagattttctactgcttctcaacaacccgg
gagaacgagaccactgtcctgtatcggcgcctctatgggccccagaccctcctcttctct
ctcttctggcccaccttcctgctgaccggaggtctcctcatcatcgccatggtcaagata
aaccagtccctttccatcctggcagctcagaggtag

DBGET integrated database retrieval system