KEGG   Canis familiaris (dog): 404014Help
Entry
404014            CDS       T01007                                 

Gene name
USP11
Definition
ubiquitin specific peptidase 11 (EC:3.4.19.12)
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     404014 (USP11)
Peptidases [BR:cfa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   404014 (USP11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
X
AA seq 770 aa AA seqDB search
MDTPHTAQFSHTDSVDLVLRTAREHFLVSPQEETRLWIKNAEGSFERLCNTRVTVLDAAL
KTGQVVIMETRNKDGTWPSAQPQAVNTALEEEEDFQGQPGICGLTNLGNTCFMNSALQCL
SNVPQLTEYFLKNHYLEELNFCNPLGMKGEIAEAYADLVKQAWSGHHRSIVPHVFKTKVG
HFASQFLGYQQHDSQELLSFLLDGLHEDLNRVKKKEYVELCDAAGRPDQEVAQEAWQNHK
RRNDSVIVDTFHGLFKSTLVCPDCGNVSVTFDPFCYLSVPLPVSHKRVMEVFFVSMDPRR
KPEQHRLVVPKKGKISDLCVALAKHTGMSPERMMVADVFSHRFYKIYQLEESLSSILDRD
DIFIYEVSGRSAIGENSREDVVLPIYLRERTPARDYNNSYYGLMLFGHPLLVSVPRDRLS
WDALYHILLYRLSRYVTRPSSDDEDDGDEKGKEEEGERIDKDEADIEDKDNIPKPGHVAG
ASSQDSGPEQAGPSSGVAGGSRAPVDNSPGPSHWPQRARRKHLFTLQTVNSNGTSDRSTF
NEDTHAQPYIAIDWEPEMKKRYYDEVEAEGYVKHDCVGYVLKKAPVRLQECIELFTTVET
LEKENPWFCPTCKQHQLATKKLDLWMLPETLIIHLKRFSYTKFSREKLDTLVEFPIRDLD
FSEFVIKPQNESAPELYKYDLIAVSNHYGGLRDGHYTTFACNKDSGQWHYFDDNSVSPVT
ENQIESKAAYVLFYQRQDVARRLQPQPSSSDPPASPACGSPPNSEFMDVN
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atggacacacctcacactgctcaattcagccatacagattctgttgacctcgttttgcgc
accgcccgagagcacttcctggtgagccctcaggaagagacacggctgtggatcaagaac
gcagagggctctttcgagaggttgtgcaacacacgtgtcacagtgcttgacgctgccctc
aagacagggcaggtggtcattatggagacccgaaacaaggatggcacttggcccagtgcc
cagccacaggccgtgaacactgcattggaggaggaggaggatttccagggccagccaggc
atctgcggtctcaccaacctgggcaacacgtgcttcatgaactcagccctgcagtgcctc
agcaatgtgccacagctcaccgagtacttcctcaaaaaccactacctggaagagctcaac
ttctgcaacccactgggcatgaagggtgagatcgcagaggcctacgcagacctggtgaag
caggcctggtccggccaccaccggtccattgtgccccatgtgttcaagaccaaggttggc
cactttgcatcccagtttctgggctaccagcagcatgactcacaggagctgctgtcgttc
ctcctggatgggctacatgaggacctcaatcgtgtcaagaagaaggaatatgtggagttg
tgtgatgctgctggacggccagatcaggaggtcgctcaggaggcctggcagaaccacaaa
cggcggaatgattctgtgattgtggacactttccatggtctcttcaagtccacgctggtg
tgccctgattgcggcaacgtatctgtgaccttcgaccctttctgctacctcagtgtccca
ctgcctgtcagccacaagagggtcatggaggtcttctttgtctccatggatcctcgccgc
aagccggagcagcaccggctcgtggtccccaagaagggcaagatctcggatctgtgtgtg
gctctggccaaacacactggcatgtcaccagaaaggatgatggtggctgacgtctttagc
caccgcttctataagatctaccagctggaggagtctctgagcagcatcttggaccgcgat
gatattttcatatatgaggtgtcgggcaggtctgctattggtgaaaactccagggaagac
gttgtgcttcctatctacctgcgggagcgcaccccagcccgggactacaacaactcctac
tatggcctgatgctctttgggcaccctctcctggtgtcggtgccccgtgaccggctctcc
tgggatgccctctatcacatcctgctgtaccgcctctcgcgctatgtgaccagacccagc
tcggatgacgaagatgacggggatgagaaaggtaaggaagaggaaggagaaaggatcgac
aaggatgaggcagacatagaggataaggacaacatccccaaaccaggacacgtggctggg
gccagctcccaggattctgggccggagcaggcggggcccagctctggagtcgcaggcgga
agccgtgcccccgtggataactcccctggaccatctcactggccccagagggcacggcgc
aagcacctgttcaccctgcagacagtgaactccaatgggaccagcgaccgctcaaccttc
aacgaggatacccatgcccagccgtacattgccatcgattgggagccagagatgaagaag
cgttactatgacgaggtggaggccgagggctacgtgaaacatgactgtgttgggtacgtg
ctgaagaaggctcctgtgcggctgcaggagtgcattgagctcttcaccactgtcgagact
ctggagaaggaaaatccctggttctgccccacctgcaagcagcaccagctggccaccaag
aagctggacctgtggatgctgcccgagacactcatcatccacctgaagcgcttctcctat
accaagttctcccgcgagaagctggacacccttgtggagtttcctatccgggacctggac
ttctctgagtttgtcatcaagccgcagaatgagtccgctccagagctgtacaaatatgat
ctcatcgcagtttccaatcattacgggggcctgcgtgacggacactacacaacatttgct
tgcaacaaagacagcggccagtggcattacttcgatgacaacagtgtctcacctgtaact
gagaatcagatcgagtccaaggcagcctatgtcctcttctaccaacgccaggatgtggcg
cgtcgcctgcaaccccagcccagttcatctgaccccccggcatctcctgcctgcggttcc
ccacccaactctgagttcatggatgtaaactaa

DBGET integrated database retrieval system