KEGG   Canis familiaris (dog): 404306Help
Entry
404306            CDS       T01007                                 

Gene name
EGFR
Definition
epidermal growth factor receptor
Orthology
K04361  
epidermal growth factor receptor [EC:2.7.10.1]
Organism
cfa  Canis familiaris (dog)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
Cytokine-cytokine receptor interaction
HIF-1 signaling pathway
FoxO signaling pathway
Endocytosis
PI3K-Akt signaling pathway
Dorso-ventral axis formation
Focal adhesion
Adherens junction
Gap junction
Regulation of actin cytoskeleton
GnRH signaling pathway
Estrogen signaling pathway
Oxytocin signaling pathway
Hepatitis C
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Melanoma
Bladder cancer
Non-small cell lung cancer
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:cfa04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:cfa04015]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:cfa04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:cfa04012]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:cfa04066]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:cfa04068]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:cfa04020]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:cfa04151]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:cfa04060]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:cfa04144]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:cfa04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:cfa04510]
Cellular Processes; Cell communication; Adherens junction [PATH:cfa04520]
Cellular Processes; Cell communication; Gap junction [PATH:cfa04540]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:cfa04912]
Organismal Systems; Endocrine system; Estrogen signaling pathway [PATH:cfa04915]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:cfa04921]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:cfa04320]
Human Diseases; Cancers; Pathways in cancer [PATH:cfa05200]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:cfa05206]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:cfa05205]
Human Diseases; Cancers; Pancreatic cancer [PATH:cfa05212]
Human Diseases; Cancers; Glioma [PATH:cfa05214]
Human Diseases; Cancers; Melanoma [PATH:cfa05218]
Human Diseases; Cancers; Bladder cancer [PATH:cfa05219]
Human Diseases; Cancers; Prostate cancer [PATH:cfa05215]
Human Diseases; Cancers; Endometrial cancer [PATH:cfa05213]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:cfa05223]
Human Diseases; Infectious diseases; Hepatitis C [PATH:cfa05160]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
18
AA seq 1180 aa AA seqDB search
MAVCQGTSNRLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYMQRNYDLSFLKTIQEVAG
YVLIALNTVEKIPLENLQIIRGNVLYENTHALSVLSNYGSNKTGLQELPLRNLHEILQGA
VRFSNNPVLCNVETIQWRDIVDNDFISNMSMDIQNQAGRCQKCDPSCPNGSCWGPGKENC
QKLTKIICAQQCSGRCRGRSPSDCCHNQCAAGCTGPRESDCLVCRKFRDEATCKDTCPPL
MLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYVVTDHGSCVRACSSDSYEVEEDGVRKCK
KCEGPCRKVCNGIGIGEFKDTLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTLPL
DPKELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVGLNITS
LGLRSLKEISDGDVIISGNRKLCYANTINWKKLFGTSSQKTKIINNKDEKACKAIGHVCH
PLCSSEGCWGPGPRDCVSCRNVSRGKECVEKCNILEGEPREFVENSECIQCHPECLPQAM
NITCTGRGPDSCIKCAHYIDGPHCVKTCPAGIMGENNTLVWKFSDGSRMCHLCHPNCTYG
CEGPGLEGCAKPGPKIPSIATGIVGGLLLVVVVALGVGLFLRRRHIVRKRTLRRLLQERE
LVEPLTPSGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKEL
REATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKD
NIGSQHLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEK
EYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISTIL
EKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERM
HLPSPTDSNFYRALMDEEDMEDVVDADEYLIPQQGFFHSPSTSRTPLLSSLSATSNSSNV
ACIDRNGTCPLKEDSFLQRYSSDPTGTLTEDNIDDTFLPAPEYINQSVPKRPAGSVQNPV
YHNQPLNPAPARDPHYQNPHSNAVDNPEYLNTHPTCVNSVLDRPSLWTQEANHQISLDNP
DYQQDFFPKEAKSNGIFKGPAAENADYLRVAPPSSEFIGA
NT seq 3543 nt NT seq  +upstreamnt  +downstreamnt
atggcggtctgccaaggcacgagtaaccggctcacccagttgggcacttttgaagaccac
tttctgagccttcagaggatgttcaataactgtgaggtggtcctggggaatttggaaatt
acctacatgcaaaggaattatgacctttccttcttaaagaccatccaggaagttgccggg
tatgtattgattgccctcaacacggtggagaagattcctttggaaaacctgcagatcatc
cgaggaaatgtgctctatgaaaacacccatgccttatccgtcctctccaactatggctca
aataaaactggactgcaggagcttcccctgagaaacttgcatgaaatactacaaggcgct
gtgcgcttcagcaataaccctgtcctctgcaacgtggaaaccatccagtggcgggacatc
gttgacaacgattttataagcaacatgtcgatggacatccagaaccaagcgggcaggtgc
caaaagtgtgatccaagctgtcccaatggaagttgctggggtccgggaaaggagaattgc
cagaaactgaccaaaatcatctgtgcccagcagtgttcggggcgctgccgcggcaggtcc
cccagcgactgctgccacaaccagtgtgccgccggctgcacggggccccgcgagagcgac
tgcctggtctgccgcaagttccgggatgaagccacgtgcaaggacacctgcccgcccctc
atgctctacaaccccaccacctaccaaatggacgtcaacccagagggaaaatacagcttt
ggtgccacctgcgtgaagaaatgcccccgcaactacgtggtgacagaccacggttcatgt
gtccgcgcctgcagctctgacagctacgaggtggaggaggatggtgtccgcaagtgtaag
aagtgtgaggggccttgtcgcaaagtttgtaatggaatagggattggagagttcaaagac
acactttccataaatgctacaaacattaaacacttcaaaaactgcacgtcgatcagtgga
gaccttcatatcttgccagtcgcatttagaggtgactccttcacgcataccctacctcta
gatccgaaggagctggatatcctgaaaactgtcaaggaaataacagggtttttgctgatt
caggcctggcccgaaaataggactgacctccatgctttcgagaacctagaaatcatacgt
ggaagaacaaagcaacatggccagttttctctggcggtcgtcggcctgaacataacgtcc
ttgggattacgctccctcaaggagataagcgatggagatgtgatcatctctggaaaccga
aaattgtgctatgcaaatacaataaactggaagaaactctttgggacttcaagtcagaaa
accaaaattataaacaacaaagatgaaaaagcctgcaaggccataggccacgtctgccat
ccattgtgctcctcagaaggctgctggggcccagggccgagagactgcgtgtcctgccga
aacgtcagccgtggcaaggaatgtgtggaaaagtgcaacattctggagggggagccaagg
gagtttgtggagaattcggagtgcatacagtgccatccggaatgcctgccccaggccatg
aacataacctgcacaggacgggggccggacagctgcatcaagtgcgcccactacatcgat
ggccctcactgcgtcaagacctgcccggctggcatcatgggagaaaacaacaccctggtc
tggaagttttcggatggcagccgcatgtgccacctgtgccatccaaactgcacctatggc
tgtgagggaccaggtcttgaaggctgtgcaaaacctgggcccaagatcccatccattgct
accgggattgtcggcggcctcctcttggtggtggtggtggcccttggagtgggcctcttt
ttgcgccggcgccacattgtccggaagcgcacgcttcgcagactgctgcaagaaagagag
cttgtcgagcctcttacacccagcggagaagctcccaaccaggctctcttgaggatctta
aaggagacggagttcaaaaagatcaaggtgctgggctctggagcattcggcacagtgtac
aagggactctggatcccagaaggcgagaaggttaaaattcccgtggccatcaaggaattg
agagaagccacgtctcccaaagccaacaaggaaattcttgatgaagcctacgtgatggcc
agtgtggacaatccccacgtgtgccgcctcctgggcatctgcctgacgtccacggtgcag
ctcatcacgcagctcatgccctttggctgcctcctggactatgtccgcgagcacaaggac
aacatcggctcccagcacctgctcaactggtgtgtgcagattgcaaagggcatgaactac
ctggaagaccggcgcttggtgcaccgcgacctggcggccaggaacgtcctggtgaagacc
ccgcagcacgtcaagatcacagattttgggctggccaaactgctgggtgccgaggagaaa
gagtaccacgcggaaggaggcaaagtgcctatcaagtggatggctttagaatcgatttta
caccgaatttatacccaccaaagcgatgtgtggagctacggcgtcaccgtgtgggagctg
atgaccttcgggtccaagccttacgacggtatccctgcaagtgagatctccaccatcctg
gagaagggagagcgcctcccgcagccgcccatatgcaccatcgatgtctacatgatcatg
gtcaagtgctggatgatagatgcagacagtcgcccaaaattccgtgagttgatcatcgaa
ttctccaaaatggcccgagacccgcagcgctaccttgtcatccagggagatgagaggatg
catttgccaagccctacagactccaatttttaccgcgccctgatggacgaggaggacatg
gaggatgttgtggatgctgacgagtacctcatcccccagcagggcttcttccacagcccc
tccacttcccggacccccctcctaagttctctgagcgccaccagcaacagttccaacgtg
gcttgcatcgaccgaaatgggacctgtcccctcaaagaagacagcttcttgcagcggtac
agctcagaccccactggcaccttgacggaggacaacatagatgacactttcctcccagca
cccgaatacataaaccagtctgttcccaaaaggcctgcgggttctgtccagaatcccgtc
tatcacaatcagcctctaaatccagctcctgccagagaccctcactaccaaaatccccac
agcaacgcagtggacaaccctgagtatctcaacacccaccccacctgcgtcaacagtgtc
ctcgacaggcccagcctctggacccaggaggccaaccaccaaatcagcctggacaaccct
gactaccagcaggacttctttcccaaggaagccaagtccaatggcatttttaagggccct
gcagctgaaaatgcagactacctgagggtagcgccaccaagcagtgagtttattggagcg
tga

DBGET integrated database retrieval system