KEGG   Canis familiaris (dog): 415120Help
Entry
415120            CDS       T01007                                 

Gene name
CYP2D15, CYP2D
Definition
cytochrome P450 2D (EC:1.14.14.1)
Orthology
K07414  
cytochrome P450, family 2, subfamily D [EC:1.14.14.1]
Organism
cfa  Canis familiaris (dog)
Pathway
Steroid hormone biosynthesis
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    415120 (CYP2D15)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    415120 (CYP2D15)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     415120 (CYP2D15)
Cytochrome P450 [BR:cfa00199]
 Cytochrome P450, animal type
  CYP2 family
   415120 (CYP2D15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 500 aa AA seqDB search
MGLLTGDTLGPLAVAVAIFLLLVDLMHRRRRWATRYPPGPTPVPMVGNLLQMDFQEPICY
FSQLQGRFGNVFSLELAWTPVVVLNGLEAVREALVHRSEDTADRPPMPIYDHLGLGPESQ
GLFLARYGRAWREQRRFSLSTLRNFGLGRKSLEQWVTEEASCLCAAFAEQAGRPFGPGAL
LNKAVSNVISSLTYGRRFEYDDPRLLQLLELTQQALKQDSGFLREALNSIPVLLHIPGLA
SKVFSAQKAIITLTNEMIQEHRKTRDPTQPPRHLIDAFVDEIEKAKGNPKTSFNEENLCM
VTSDLFIAGMVSTSITLTWALLLMILHPDVQRRVQQEIDEVIGREQLPEMGDQTRMPFTV
AVIHEVQRFGDIVPLGVPHMTSRDTEVQGFLIPKGTTLITNLSSVLKDEKVWKKPFRFYP
EHFLDAQGHFVKHEAFMPFSAGRRVCLGEPLARMELFLFFTCLLQRFSFSVPAGQPRPSD
HGVFTFLKVPAPFQLCVEPR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggggctgctgaccggggacacgctggggcccctggccgtagccgtggccatcttcctg
ctcctggtagacctgatgcaccggcgcaggcgctgggccacacgctacccgccaggcccc
acgccagtgcccatggtgggcaacctgctgcagatggacttccaggaaccaatctgctac
ttcagccagctgcaaggccgcttcggaaacgtgttcagcctggagctggcctggacgccg
gtggtcgtgctcaacggcctggaggcggtgcgcgaggccctggtgcaccgcagcgaggac
actgccgaccgcccacctatgccgatctatgaccacctgggtttggggccagaatcccaa
gggttgttcctggcgcgctacgggcgcgcgtggcgcgagcagcggcgcttctcgctgtcc
accctgcgcaacttcggcctgggcaggaagtccctggagcagtgggtgaccgaggaggcc
tcgtgcctctgcgcggccttcgccgagcaggcgggccgccccttcggccccggcgcgctg
ctgaacaaggcggtgagcaacgtgatctcgtcgctcacctacgggcgccgcttcgagtac
gacgacccgcggctgctccagctgctggagctcacccagcaggcgctgaagcaggactcc
ggcttcctgcgtgaggccctgaactccatccccgtgctcctgcacatcccgggactggcc
agcaaggtcttctccgcgcagaaggccatcataaccctgacaaatgaaatgatccaggag
cacaggaagacccgggaccccacccagccaccccgacacctgatcgacgccttcgtggat
gagatagaaaaagccaaagggaaccccaagaccagcttcaatgaggagaacctgtgcatg
gtgacctctgacctgttcatcgctgggatggtgtccacctcaatcacgctgacctgggcc
ctcctgctcatgatcctgcacccggacgtgcagcgacgtgtccagcaggagatagatgag
gtgatagggcgggagcagctaccagagatgggagaccagacccgtatgcccttcaccgtg
gccgtgatccatgaggtgcagcgttttggggacatcgtcccactcggtgtgccccacatg
acgtcccgagacactgaagtgcagggcttcctcatccccaaggggacgacactcatcacc
aacctgtcgtcagtgctaaaggacgagaaggtctggaagaagcccttccgcttctacccc
gagcacttcctggacgcccagggccacttcgtcaagcatgaggccttcatgcccttctct
gcaggccgccgcgtctgcctcggggagcccctggcccgcatggagctcttcctcttcttc
acctgcctcctgcagcgcttcagcttttcagtgcctgcggggcagccccggcccagcgac
cacggggtcttcaccttcctgaaggttccagcccccttccagctctgtgtggagcctcgc
tag

DBGET integrated database retrieval system