KEGG   Canis familiaris (dog): 415120Help
Entry
415120            CDS       T01007                                 

Gene name
CYP2D15, CYP2D
Definition
cytochrome P450 2D (EC:1.14.14.1)
Orthology
K07414  
cytochrome P450, family 2, subfamily D [EC:1.14.14.1]
Organism
cfa  Canis familiaris (dog)
Pathway
Steroid hormone biosynthesis
Serotonergic synapse
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:cfa00140]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:cfa04726]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 500 aa AA seqDB search
MGLLTGDTLGPLAVAVAIFLLLVDLMHRRRRWATRYPPGPTPVPMVGNLLQMDFQEPICY
FSQLQGRFGNVFSLELAWTPVVVLNGLEAVREALVHRSEDTADRPPMPIYDHLGLGPESQ
GLFLARYGRAWREQRRFSLSTLRNFGLGRKSLEQWVTEEASCLCAAFAEQAGRPFGPGAL
LNKAVSNVISSLTYGRRFEYDDPRLLQLLELTQQALKQDSGFLREALNSIPVLLHIPGLA
SKVFSAQKAIITLTNEMIQEHRKTRDPTQPPRHLIDAFVDEIEKAKGNPKTSFNEENLCM
VTSDLFIAGMVSTSITLTWALLLMILHPDVQRRVQQEIDEVIGREQLPEMGDQTRMPFTV
AVIHEVQRFGDIVPLGVPHMTSRDTEVQGFLIPKGTTLITNLSSVLKDEKVWKKPFRFYP
EHFLDAQGHFVKHEAFMPFSAGRRVCLGEPLARMELFLFFTCLLQRFSFSVPAGQPRPSD
HGVFTFLKVPAPFQLCVEPR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggggctgctgaccggggacacgctggggcccctggccgtagccgtggccatcttcctg
ctcctggtagacctgatgcaccggcgcaggcgctgggccacacgctacccgccaggcccc
acgccagtgcccatggtgggcaacctgctgcagatggacttccaggaaccaatctgctac
ttcagccagctgcaaggccgcttcggaaacgtgttcagcctggagctggcctggacgccg
gtggtcgtgctcaacggcctggaggcggtgcgcgaggccctggtgcaccgcagcgaggac
actgccgaccgcccacctatgccgatctatgaccacctgggtttggggccagaatcccaa
gggttgttcctggcgcgctacgggcgcgcgtggcgcgagcagcggcgcttctcgctgtcc
accctgcgcaacttcggcctgggcaggaagtccctggagcagtgggtgaccgaggaggcc
tcgtgcctctgcgcggccttcgccgagcaggcgggccgccccttcggccccggcgcgctg
ctgaacaaggcggtgagcaacgtgatctcgtcgctcacctacgggcgccgcttcgagtac
gacgacccgcggctgctccagctgctggagctcacccagcaggcgctgaagcaggactcc
ggcttcctgcgtgaggccctgaactccatccccgtgctcctgcacatcccgggactggcc
agcaaggtcttctccgcgcagaaggccatcataaccctgacaaatgaaatgatccaggag
cacaggaagacccgggaccccacccagccaccccgacacctgatcgacgccttcgtggat
gagatagaaaaagccaaagggaaccccaagaccagcttcaatgaggagaacctgtgcatg
gtgacctctgacctgttcatcgctgggatggtgtccacctcaatcacgctgacctgggcc
ctcctgctcatgatcctgcacccggacgtgcagcgacgtgtccagcaggagatagatgag
gtgatagggcgggagcagctaccagagatgggagaccagacccgtatgcccttcaccgtg
gccgtgatccatgaggtgcagcgttttggggacatcgtcccactcggtgtgccccacatg
acgtcccgagacactgaagtgcagggcttcctcatccccaaggggacgacactcatcacc
aacctgtcgtcagtgctaaaggacgagaaggtctggaagaagcccttccgcttctacccc
gagcacttcctggacgcccagggccacttcgtcaagcatgaggccttcatgcccttctct
gcaggccgccgcgtctgcctcggggagcccctggcccgcatggagctcttcctcttcttc
acctgcctcctgcagcgcttcagcttttcagtgcctgcggggcagccccggcccagcgac
cacggggtcttcaccttcctgaaggttccagcccccttccagctctgtgtggagcctcgc
tag

DBGET integrated database retrieval system