KEGG   Canis familiaris (dog): 415123Help
Entry
415123            CDS       T01007                                 

Gene name
CYP2C41
Definition
cytochrome P450 2C41 (EC:1.14.14.1)
Orthology
K07413  
cytochrome P450, family 2, subfamily C [EC:1.14.14.1]
Organism
cfa  Canis familiaris (dog)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    415123 (CYP2C41)
   00590 Arachidonic acid metabolism
    415123 (CYP2C41)
   00591 Linoleic acid metabolism
    415123 (CYP2C41)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    415123 (CYP2C41)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    415123 (CYP2C41)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    415123 (CYP2C41)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    415123 (CYP2C41)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     415123 (CYP2C41)
Cytochrome P450 [BR:cfa00199]
 Cytochrome P450, animal type
  CYP2 family
   415123 (CYP2C41)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 489 aa AA seqDB search
MDPVVVLVLCLSCCLLLSLWKQSSRKGKLPPGPTPLPFIGNILQLDKDINKSLSNLSKAY
GPVFTLYFGMKPTVVLHGYDAVKETLIDLGEEFSARGRFPIAEKVSGGHGIIFTSGNRWK
EMRRFALTTLRNLGMGKSDLESRVQEEACYLVEELRKTNALPCDPTFVLGCASCNVICSI
IFQNRFDYTDQTLIGFLEKLNENFRILSSPWIQAYNSFPALLHYLPGSHNTIFKNFAFIK
SYILEKIKEHQESFDVNNPRDFIDYFLIKMEQEKHNQPLEFTFENLKTIATDLFGAGTET
TSTTLRYGLLLLLKHPEVTVKVQEEIDRVIGRHQSPHMQDRSRMPYTNAVLHEIQRYIDL
VPNSLPHAVTCDVKFRNYVIPKGTTILISLSSVLSDEKEFPRPEIFDPAHFLDDSGNFKK
SDYFMAFSAGKRICVGEGLARMELFLFLTTILQKFTLKPLVDPKDIDTTPLASGFGHVPP
TYQLCFIPV
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggatccagttgtggttctggtgctttgtctctcctgttgccttctcctttcactctgg
aaacagagctcgaggaaggggaagctcccacctggccccacacctctcccttttattgga
aatatcctacagttagataaggacatcaacaaatccttaagtaatctctcaaaagcctat
ggccctgtattcactctgtattttggcatgaaacccactgttgtactgcatgggtatgac
gcagtgaaggaaaccctgattgatctgggagaagagttttctgcaagaggacgtttccca
atagccgaaaaagttagtggaggacacggaatcattttcaccagtggaaacagatggaag
gagatgcgacgctttgccctcacgaccctgcgaaatttggggatggggaagagtgacctt
gagagccgagttcaagaggaagcctgctaccttgtagaagagttgagaaaaaccaatgcc
ttaccatgtgatcccacttttgtcttgggctgtgcttcctgcaatgtgatctgctccatt
attttccagaatcgttttgactatacagatcagactttaattggtttcttggaaaaactt
aatgaaaacttcaggattttgagctccccatggatccaggcctacaatagtttccctgct
ctccttcattatctcccaggaagccataacacaatatttaaaaattttgctttcataaaa
agttacattttggagaaaataaaagaacaccaagaatccttcgatgttaacaatcctcgg
gatttcattgattatttcctgataaaaatggaacaggaaaagcacaaccagccattggaa
tttactttcgaaaacttgaaaactattgccactgatttgtttggagctgggacagagaca
acaagcacaaccctacgatatggtctcctgctcctgctgaaacatccagaagtcacagtg
aaagtccaggaagagattgaccgtgtaattggcagacaccagagccctcacatgcaggac
aggagtcgcatgccctacacgaatgcggtactgcatgagattcagagatacattgacctt
gtcccaaacagcctgcctcatgcagtgacctgtgacgttaaatttagaaactatgtcatc
cccaagggcacaactatattaatatcactgtcttctgtgctatctgatgaaaaagaattc
cccagaccagagatatttgaccctgcccacttcctggatgatagcggcaacttcaagaag
agtgactacttcatggctttctcagcaggaaaacgaatttgtgtgggagaaggactggcc
cgcatggagctgtttttattcctgaccaccattttacaaaaatttaccctgaaacctctg
gtcgatccaaaggacattgataccaccccacttgccagtgggtttggccatgtcccaccc
acctaccagctctgcttcattcccgtgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system