KEGG   Canis familiaris (dog): 415124Help
Entry
415124            CDS       T01007                                 

Gene name
CYP21A2, CYP21, CYP21A
Definition
(RefSeq) cytochrome P450c21 (EC:1.14.99.10)
  KO
K00513  
steroid 21-monooxygenase [EC:1.14.14.16]
Organism
cfa  Canis familiaris (dog)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Aldosterone synthesis and secretion
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    415124 (CYP21A2)
 Organismal Systems
  Endocrine system
   04925 Aldosterone synthesis and secretion
    415124 (CYP21A2)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.16  steroid 21-monooxygenase
     415124 (CYP21A2)
Cytochrome P450 [BR:cfa00199]
 Cytochrome P450, animal type
  CYP21 family
   415124 (CYP21A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
12
AA seq 492 aa AA seqDB search
MLLLGVLLLTVLAGARLLWGKWKLRGLHLPPLVPGCLHLLQPDLPLHLLGLTQKLGPIYR
LRLGLQDVEVLNSKRTIEEAMVRKWVDFAGRPQTPSYKLVSLHHQDLSLGDYSLLWKAHK
KLTRSALLLGIRSSMEPLVEQLTQEFCERMRAQAGTPVAIQKEFSLLTCAIICHLTFGNK
EDTLVHTFHDCVQDLMRTWEHWSIQMLDIIPFLRFFPNPGLWRLKRALENRDHIVEKQLR
QHKESMVAGQWRDMTDYMLQRVGRLRAEEGCGQLLEGHVHMSVVDLFIGGTETTATTLSW
AVAFLLHHPEIQQRLQEELDRELGPGASGSRIPYRDPTRLPLLSATVAEVLRLRPVVPLA
LPHCTTRPNSISGYDIPEGMVVIPNLQGAHLDETVWERPQEFRPDRFLVPGASPRVLAFG
CGARVCLGEPLARLELLVVLAQLLRAFTLMPAAGTLPSLRPRARCGVNLSMQPFQVQLQP
RGAGVLGRGQHP
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgctactcctcggggtgctgctgctgactgtgctggctggtgcccgcctgctgtggggc
aagtggaagctcaggggtctgcacctcccacctcttgtccctggctgcctgcacctgctg
cagcccgaccttcccctccacctgctgggtttgacgcagaaactggggcccatctacagg
ctccgcctggggctgcaagatgtggaggtgctgaattctaagaggaccatcgaggaagcc
atggtcaggaaatgggtggacttcgccggcagaccgcagacgccatcctacaagctggtg
tctctgcaccaccaggacctgtccctgggggactactccctgctgtggaaggctcacaag
aaactcacccgctcagccctgctgctgggcatccgcagctccatggagccgctggtggag
cagctgacccaggagttctgtgagcgcatgagagcccaggctggcacccctgtggccatc
cagaaggaattctctttgctcacctgcgccatcatctgtcacctcaccttcggaaacaag
gaggacaccttagtacatacctttcatgactgtgttcaagacctgatgagaacctgggag
cactggtccatccaaatgttggacatcattccctttctcaggttttttcccaacccaggc
ctctggaggctgaagcgagccttggagaaccgggaccacatcgtagagaagcagctgagg
cagcacaaggagagcatggtggcaggccagtggagggacatgaccgactacatgctccag
agggtggggaggctgagagcagaagagggctgtggacagctcctcgaaggacacgtgcac
atgtccgtggtggaccttttcattggcggcaccgagaccacggccaccaccctctcctgg
gccgtggcgttcttgcttcaccaccctgagattcagcagcgactgcaggaagagctggat
cgggagctgggtcctggagcttcaggctcccgaatcccgtacagagaccccacacgcctg
cccctgctcagcgccaccgttgccgaggtgctgcgcctgcggcccgtcgtgcccctggcc
ctgccgcactgcaccacgcggcccaacagtatctcgggctacgacatccccgagggcatg
gttgtcatacccaacctgcaaggcgcccacttagacgagacggtctgggagcggccacag
gagttccggcccgatcgcttcctggtccccggcgccagccccagagtgctggccttcggc
tgcggggcgcgtgtgtgcctgggggagccgctggcacgccttgagctcctggtggtgctg
gcgcagctgctccgggccttcacgctgatgcccgctgcgggcaccctgccctctctgcga
ccccgggcccgctgcggcgtcaacctcagcatgcagcctttccaggtgcagctgcagccc
cggggggcaggagtcctgggacgtggccagcacccatga

DBGET integrated database retrieval system