KEGG   Canis familiaris (dog): 415124Help
Entry
415124            CDS       T01007                                 

Gene name
CYP21A2, CYP21, CYP21A
Definition
cytochrome P450c21 (EC:1.14.99.10)
Orthology
K00513  
steroid 21-monooxygenase [EC:1.14.99.10]
Organism
cfa  Canis familiaris (dog)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    415124 (CYP21A2)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.10  steroid 21-monooxygenase
     415124 (CYP21A2)
Cytochrome P450 [BR:cfa00199]
 Cytochrome P450, animal type
  CYP21 family
   415124 (CYP21A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
12
AA seq 492 aa AA seqDB search
MLLLGVLLLTVLAGARLLWGKWKLRGLHLPPLVPGCLHLLQPDLPLHLLGLTQKLGPIYR
LRLGLQDVEVLNSKRTIEEAMVRKWVDFAGRPQTPSYKLVSLHHQDLSLGDYSLLWKAHK
KLTRSALLLGIRSSMEPLVEQLTQEFCERMRAQAGTPVAIQKEFSLLTCAIICHLTFGNK
EDTLVHTFHDCVQDLMRTWEHWSIQMLDIIPFLRFFPNPGLWRLKRALENRDHIVEKQLR
QHKESMVAGQWRDMTDYMLQRVGRLRAEEGCGQLLEGHVHMSVVDLFIGGTETTATTLSW
AVAFLLHHPEIQQRLQEELDRELGPGASGSRIPYRDPTRLPLLSATVAEVLRLRPVVPLA
LPHCTTRPNSISGYDIPEGMVVIPNLQGAHLDETVWERPQEFRPDRFLVPGASPRVLAFG
CGARVCLGEPLARLELLVVLAQLLRAFTLMPAAGTLPSLRPRARCGVNLSMQPFQVQLQP
RGAGVLGRGQHP
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgctactcctcggggtgctgctgctgactgtgctggctggtgcccgcctgctgtggggc
aagtggaagctcaggggtctgcacctcccacctcttgtccctggctgcctgcacctgctg
cagcccgaccttcccctccacctgctgggtttgacgcagaaactggggcccatctacagg
ctccgcctggggctgcaagatgtggaggtgctgaattctaagaggaccatcgaggaagcc
atggtcaggaaatgggtggacttcgccggcagaccgcagacgccatcctacaagctggtg
tctctgcaccaccaggacctgtccctgggggactactccctgctgtggaaggctcacaag
aaactcacccgctcagccctgctgctgggcatccgcagctccatggagccgctggtggag
cagctgacccaggagttctgtgagcgcatgagagcccaggctggcacccctgtggccatc
cagaaggaattctctttgctcacctgcgccatcatctgtcacctcaccttcggaaacaag
gaggacaccttagtacatacctttcatgactgtgttcaagacctgatgagaacctgggag
cactggtccatccaaatgttggacatcattccctttctcaggttttttcccaacccaggc
ctctggaggctgaagcgagccttggagaaccgggaccacatcgtagagaagcagctgagg
cagcacaaggagagcatggtggcaggccagtggagggacatgaccgactacatgctccag
agggtggggaggctgagagcagaagagggctgtggacagctcctcgaaggacacgtgcac
atgtccgtggtggaccttttcattggcggcaccgagaccacggccaccaccctctcctgg
gccgtggcgttcttgcttcaccaccctgagattcagcagcgactgcaggaagagctggat
cgggagctgggtcctggagcttcaggctcccgaatcccgtacagagaccccacacgcctg
cccctgctcagcgccaccgttgccgaggtgctgcgcctgcggcccgtcgtgcccctggcc
ctgccgcactgcaccacgcggcccaacagtatctcgggctacgacatccccgagggcatg
gttgtcatacccaacctgcaaggcgcccacttagacgagacggtctgggagcggccacag
gagttccggcccgatcgcttcctggtccccggcgccagccccagagtgctggccttcggc
tgcggggcgcgtgtgtgcctgggggagccgctggcacgccttgagctcctggtggtgctg
gcgcagctgctccgggccttcacgctgatgcccgctgcgggcaccctgccctctctgcga
ccccgggcccgctgcggcgtcaacctcagcatgcagcctttccaggtgcagctgcagccc
cggggggcaggagtcctgggacgtggccagcacccatga

DBGET integrated database retrieval system