KEGG   Canis familiaris (dog): 415129Help
Entry
415129            CDS       T01007                                 

Gene name
CYP3A12, P450IIIA
Definition
cytochrome P-450 3A12 (EC:1.14.14.1)
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
cfa  Canis familiaris (dog)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    415129 (CYP3A12)
   00591 Linoleic acid metabolism
    415129 (CYP3A12)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    415129 (CYP3A12)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    415129 (CYP3A12)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     415129 (CYP3A12)
Cytochrome P450 [BR:cfa00199]
 Cytochrome P450, animal type
  CYP3 family
   415129 (CYP3A12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 503 aa AA seqDB search
MDLIPSFSTETWLLLAISLVLLYLYGTYTHGIFRKLGIPGPTPLPFVGTALGYRNGFYVF
DMKCFSKYGRMWGFYDGRQPVLAITDPDMIKTVLVKECYSVFTNRRTLGPVGFMKSAISL
SEDEEWKRMRTLLSPTFTTGKLKEMFPIIGQYGDVLVNNLRKEAEKGKAINLKDVFGAYS
MDVITSTSFGVNIDSLNHPQDPFVENTKKLLKFDFLDPFFFSILLFPFLTPVFEILNIWL
FPKKVTDFFRKSVERMKESRLKDKQKHRVDFLQLMINSQNSKEMDTHKALSDLELVAQSI
IFIFAGYETTSTSLSFLMYELATHPDVQQKLQEEIDATFPNKALPTYDALVQMEYLDMVL
NETLRLYPIAGRLERVCKKDVEISGVFIPKGTVVMVPTFTLHRDQSLWPEPEEFRPERFS
RKNKDSINPYTYLPFGTGPRNCIGMRFAIMNMKLALVRVLQNFSFKPCKETQIPLKLNAQ
GIIQPEKPIVLKVEPRDGSVNGA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggacttgatcccaagcttttccacagaaacctggcttcttctggctatcagcctggtg
ctcctctatctgtatgggacctacacacatgggatttttaggaagctgggaattcctggg
ccaacacctctgccttttgtgggaactgctctgggctaccgtaatggtttttatgttttt
gacatgaaatgttttagtaagtatggaagaatgtgggggttttatgatgggcgacagcct
gtgctggctatcacagatccggacatgatcaaaacagtactagtgaaagaatgttattct
gtcttcacaaaccggcggactcttggtccagtaggatttatgaaaagtgcgatctctctg
tctgaggatgaagagtggaagagaatgcgaactttgctgtctccaaccttcaccactgga
aagctcaaggagatgttccccatcattggccagtatggagatgtgttggtgaacaacctg
aggaaggaggcagagaaaggcaaggccatcaacttgaaagatgtctttggagcctacagc
atggatgtgattaccagcacatcgtttggagtgaacattgattccctcaaccacccacaa
gatccgtttgtggaaaataccaagaagctcttaaaatttgatttccttgacccatttttc
ttctccatattactgtttccattccttactccggtttttgaaatattaaatatctggcta
tttccaaagaaagttactgattttttcagaaaatctgtagagagaatgaaggaaagtcgc
ctaaaagataaacaaaagcaccgagtggactttcttcagctgatgattaactcccagaat
tccaaagaaatggacactcataaagctctatctgatttggagctggtggcccaatctatt
atctttatttttgctggctatgagaccactagcacttctctttccttccttatgtatgaa
ttggccactcaccctgatgtccagcagaaactgcaggaggagattgatgcgactttcccc
aataaggcattgcccacttacgatgcccttgtgcagatggaatatctggacatggtgttg
aatgaaactctccgattatacccaatcgctggtagacttgagagggtctgtaagaaagat
gtggaaatcagtggtgtgttcattcccaaagggacagtggtgatggtgccaacctttact
cttcatcgagaccagagtctctggccagagcctgaggaattccgacctgaaaggttcagt
aggaagaacaaggacagcataaatccttatacatacctgccttttggaactggaccccga
aactgcattggaatgaggtttgcgatcatgaacatgaaacttgcccttgttagggtcctg
cagaacttctccttcaaaccttgtaaagaaacacagatccccctgaaattaaatgctcaa
gggattattcaacctgaaaagcccattgttctcaaggttgagccaagagatgggagtgta
aatggagcctga

DBGET integrated database retrieval system