KEGG   Canis familiaris (dog): 442961Help
Entry
442961            CDS       T01007                                 

Gene name
GPX1
Definition
glutathione peroxidase 1 (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cfa  Canis familiaris (dog)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Thyroid hormone synthesis
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:cfa00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:cfa00480]
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:cfa04918]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
20
AA seq 205 aa AA seqDB search
MCAAALAAAAVAAAPRSVYAFSARPLAGGEPMSLGSLRGKVLLIENVASLUGTTVRDYTQ
MNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFTLFEKCEVN
GAQAHPLFAFLRESLPAPSDDTTALMTDPKFITWSPVCRNDVAWNFEKFLVGPDGVPVRR
YSRRFPTIDIEPDIEALLSQGPSCA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgcggctgcccttgccgcagctgccgtggcggcggccccgcgctccgtgtacgcc
ttctcagcgcgtccgctggccggcggggaacctatgagcctgggttccctgcggggcaag
gtgctgctcatcgagaatgtggcgtcgctctgaggcacaacggtccgggactacacccag
atgaacgagctgcagcggcgcctcggaccccggggcctggttgtgctcggcttcccgtgc
aaccagttcgggcatcaggaaaacgctaagaacgaagagatcctgaattccctcaagtac
gttcgacctggcggcgggttcgagcccaacttcacgctttttgagaagtgcgaggtgaac
ggcgcgcaggcgcaccccctcttcgccttcctgcgggagtctctgcctgcccccagtgac
gacaccactgcgctaatgaccgaccccaagttcatcacctggtccccggtgtgccgcaac
gacgttgcctggaactttgagaagttcctagtgggcccagatggtgtgcctgtgcgcagg
tatagccgccgcttcccaaccatcgatatcgagcctgacatcgaagccttgctgtcccag
gggcccagctgtgcctag

DBGET integrated database retrieval system