KEGG   Canis familiaris (dog): 442984Help
Entry
442984            CDS       T01007                                 

Gene name
UGT2B31
Definition
UDP-glucuronosyltransferase UGT2B31 (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
cfa  Canis familiaris (dog)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    442984 (UGT2B31)
   00053 Ascorbate and aldarate metabolism
    442984 (UGT2B31)
   00500 Starch and sucrose metabolism
    442984 (UGT2B31)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    442984 (UGT2B31)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    442984 (UGT2B31)
   00860 Porphyrin and chlorophyll metabolism
    442984 (UGT2B31)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    442984 (UGT2B31)
   00982 Drug metabolism - cytochrome P450
    442984 (UGT2B31)
   00983 Drug metabolism - other enzymes
    442984 (UGT2B31)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    442984 (UGT2B31)
Enzymes [BR:cfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     442984 (UGT2B31)
Glycosyltransferases [BR:cfa01003]
 Others
  Hydrophobic molecule
   442984 (UGT2B31)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
13
AA seq 530 aa AA seqDB search
MSMKWISVLLGLQLSCYFSSGSCGKVLVWPTEYSHWINVKTILDELVQRGHEVTVLTSSA
SILVDPNKLSAIKFEIYSAHLSRGDFEAFFIKLLNILIYDMPKDSFWTYFSLMQEFFWEF
YECAQKLCKDVVLNKKLMTKLQESKFDLVLADTIIPCGELLAELLKIPLVYSLRFSPGYA
FEKHSGGLPLPPSYVPVILSELTDQMTFMERVKNMLYVLYFDFWFQTINEKSWDQFYSEV
LGRPTTLYELMRKADIWLIRTYWDFEYPHPLLPHFDFVGGLHCKPAKSLPTEMEEFVQSS
GENGIVVFSLGSMVNNMTEERANVIASALAQIPQKVLWRFDGKKPDTLGPNTRLYKWLPQ
NDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQADNIVHMKAKGAAIRLDFST
MSSADLLNALRMVINDPSYKENAMKLSGIHHDQPIKPLDRAVFWIEYVMRHQGAKHLRPA
SHDLTWFQYHSLDVIGFLLACVATAIFVTTQCCLFCCRKVAKTGKKIKKE
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgaaatggatttcagtgcttctggggctacagctgagctgttactttagctct
gggagttgcgggaaggtgctggtgtggcccacggaatacagccactggatcaatgtaaag
acaatcctggatgaacttgtccagaggggtcatgaagtgactgttctgacatcgtcagct
tccattcttgttgatccgaacaaattatctgctattaaatttgagatttattctgcacat
ttatctagaggtgattttgaggctttcttcataaaactgctcaacattttgatatatgat
atgccaaaagattcattttggacatatttttcattaatgcaagaatttttttgggaattt
tatgaatgtgctcagaagctctgtaaagatgtagttttgaacaagaaactcatgacaaaa
ctacaagaatcaaaatttgatctcgtccttgcagatactatcataccctgcggtgagctg
ctggctgagctccttaaaatacctttagtgtacagtctccgtttctctccaggctacgca
tttgagaaacacagtggaggacttcctctccctccatcctacgtacctgttattctgtca
gaattaactgatcaaatgacattcatggagagagtaaaaaatatgctgtatgtgctttat
tttgacttttggttccaaacaataaatgagaagagttgggatcagttttacagcgaagta
ctaggaagacccactacactatatgagttaatgaggaaagctgatatatggctcattcga
acctactgggattttgaatatcctcacccactcttaccacattttgactttgttggaggc
ctccactgcaaacccgccaaatccctgcctacggaaatggaagagtttgtccagagctct
ggagaaaacggtattgtggtgttttctctagggtcaatggtcaataacatgacagaggaa
agagccaatgtgatcgcatcagcccttgcccagattccacaaaaggttctatggagattt
gatggcaagaaaccagacaccttagggccaaatactcggctgtataaatggcttccccag
aatgaccttcttggtcatccgaaaaccaaagcctttataacccatggtggaaccaacggc
atctatgaggcgatctaccacgggatccccatggtgggcattcccttgtttgccgatcaa
gctgataacattgttcacatgaaagctaagggagcagctatcagactggacttcagcaca
atgtctagtgcagacttgctcaatgcattgaggatggtcattaatgacccttcgtacaaa
gagaatgctatgaagttatcaggaattcaccacgatcagcctataaagcccctggaccgg
gcagtcttctggatcgagtatgtcatgcgccaccaaggagccaagcacctgcggccagcc
tcccatgacctcacctggttccagtaccactccttggatgtgattgggtttctgctggcc
tgtgtggcaactgctatatttgtcaccacacaatgttgtctgttttgttgtcggaaggtc
gcaaaaactgggaagaagataaaaaaggagtag

DBGET integrated database retrieval system