KEGG   Canis familiaris (dog): 445450Help
Entry
445450            CDS       T01007                                 

Gene name
COMT
Definition
catechol-O-methyltransferase (EC:2.1.1.6)
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
cfa  Canis familiaris (dog)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    445450 (COMT)
  Amino acid metabolism
   00350 Tyrosine metabolism
    445450 (COMT)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    445450 (COMT)
Enzymes [BR:cfa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     445450 (COMT)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   445450 (COMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
26
AA seq 221 aa AA seqDB search
MGDTKEQRILRHVLQHAVAGDPQSVLEAIDTYCSQKEWAMNVGDKKGQILDAVVREQRPS
VLLELGAYCGYSAVRMARLLEPGARLITIELNPDFAAITQQMLDFAGLQDRVTILTGASQ
DTIPELKKKHDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGTPEFL
AYVRGNNRFECTHFPSYLEYSKRVDGLEKVVYKGPGSPTQP
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgggggacacgaaggagcagcgcatcctgcgacatgtactccagcacgcggtggccggg
gacccacaaagtgtgctggaggccattgatacctactgctcgcagaaggagtgggccatg
aacgtgggtgacaagaaaggccagatcttggatgcagtggtgcgggagcagcggccgtcg
gtgctgctggagctgggagcctactgcggctactcggccgtgcgcatggcccgcctgctg
gagcccggggcccgcctgatcaccatcgagctcaaccctgacttcgccgccatcacccag
cagatgctggacttcgcaggcctgcaggacagggtcaccattctgaccggggcatcccag
gacaccatccccgagctgaagaagaagcatgatgtggacacgctagacatggtcttcctt
gaccactggaaggatcggtacctgccggacacactcctcctagaggagtgtggcctgcta
cggaaagggacagtgctgctggctgacaacgtcatctgcccaggaacaccagaattcctg
gcatacgtgcgtgggaacaaccgctttgagtgcacacacttcccctcgtacctggaatac
tccaagagagtggatggcctcgagaaggtggtctacaagggcccaggcagcccaacacag
ccgtga

DBGET integrated database retrieval system