KEGG   Canis familiaris (dog): 445450Help
Entry
445450            CDS       T01007                                 

Gene name
COMT
Definition
catechol-O-methyltransferase (EC:2.1.1.6)
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
cfa  Canis familiaris (dog)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Dopaminergic synapse
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:cfa00140]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:cfa00350]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:cfa04728]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
26
AA seq 221 aa AA seqDB search
MGDTKEQRILRHVLQHAVAGDPQSVLEAIDTYCSQKEWAMNVGDKKGQILDAVVREQRPS
VLLELGAYCGYSAVRMARLLEPGARLITIELNPDFAAITQQMLDFAGLQDRVTILTGASQ
DTIPELKKKHDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGTPEFL
AYVRGNNRFECTHFPSYLEYSKRVDGLEKVVYKGPGSPTQP
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgggggacacgaaggagcagcgcatcctgcgacatgtactccagcacgcggtggccggg
gacccacaaagtgtgctggaggccattgatacctactgctcgcagaaggagtgggccatg
aacgtgggtgacaagaaaggccagatcttggatgcagtggtgcgggagcagcggccgtcg
gtgctgctggagctgggagcctactgcggctactcggccgtgcgcatggcccgcctgctg
gagcccggggcccgcctgatcaccatcgagctcaaccctgacttcgccgccatcacccag
cagatgctggacttcgcaggcctgcaggacagggtcaccattctgaccggggcatcccag
gacaccatccccgagctgaagaagaagcatgatgtggacacgctagacatggtcttcctt
gaccactggaaggatcggtacctgccggacacactcctcctagaggagtgtggcctgcta
cggaaagggacagtgctgctggctgacaacgtcatctgcccaggaacaccagaattcctg
gcatacgtgcgtgggaacaaccgctttgagtgcacacacttcccctcgtacctggaatac
tccaagagagtggatggcctcgagaaggtggtctacaagggcccaggcagcccaacacag
ccgtga

DBGET integrated database retrieval system